SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019415 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019415
Domain Number 1 Region: 3-150
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.9e-53
Family Calponin-homology domain, CH-domain 0.00000445
Further Details:      
 
Domain Number 2 Region: 1480-1696
Classification Level Classification E-value
Superfamily Plakin repeat 7.19e-45
Family Plakin repeat 0.00023
Further Details:      
 
Domain Number 3 Region: 1701-1883
Classification Level Classification E-value
Superfamily Plakin repeat 6.63e-40
Family Plakin repeat 0.00071
Further Details:      
 
Domain Number 4 Region: 6299-6416
Classification Level Classification E-value
Superfamily Spectrin repeat 1.68e-28
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 5 Region: 6695-6851
Classification Level Classification E-value
Superfamily Spectrin repeat 3.77e-28
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 223-339
Classification Level Classification E-value
Superfamily Spectrin repeat 1.27e-27
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 7 Region: 6473-6634
Classification Level Classification E-value
Superfamily Spectrin repeat 1.05e-25
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 8 Region: 5271-5428
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-24
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 9 Region: 5814-5971
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-24
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 10 Region: 6055-6195
Classification Level Classification E-value
Superfamily Spectrin repeat 3.53e-24
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 11 Region: 6145-6292
Classification Level Classification E-value
Superfamily Spectrin repeat 3.8e-22
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 12 Region: 6846-6962
Classification Level Classification E-value
Superfamily Spectrin repeat 3.48e-21
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 13 Region: 4834-4989
Classification Level Classification E-value
Superfamily Spectrin repeat 1.75e-20
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 14 Region: 7182-7261
Classification Level Classification E-value
Superfamily GAS2 domain-like 6.54e-20
Family GAS2 domain 0.00059
Further Details:      
 
Domain Number 15 Region: 4502-4628
Classification Level Classification E-value
Superfamily Spectrin repeat 8.34e-19
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 16 Region: 4053-4192
Classification Level Classification E-value
Superfamily Spectrin repeat 1.13e-18
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 17 Region: 5048-5208
Classification Level Classification E-value
Superfamily Spectrin repeat 4.24e-16
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number 18 Region: 1192-1320,1347-1375
Classification Level Classification E-value
Superfamily Spectrin repeat 4.4e-16
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 19 Region: 657-759
Classification Level Classification E-value
Superfamily Spectrin repeat 6.48e-16
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 20 Region: 5424-5540
Classification Level Classification E-value
Superfamily Spectrin repeat 8.11e-16
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 21 Region: 7093-7173
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000144
Family Polcalcin 0.044
Further Details:      
 
Domain Number 22 Region: 5707-5832
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000763
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 23 Region: 5606-5754
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000758
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 24 Region: 5971-6084
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000262
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 25 Region: 3804-3926
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000497
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 26 Region: 4723-4845
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000605
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 27 Region: 3971-4084
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000262
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 28 Region: 4635-4736
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000107
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number 29 Region: 732-839,960-980
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000202
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 30 Region: 4251-4371
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000206
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 31 Region: 4410-4519
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000388
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 32 Region: 564-656
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000537
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 33 Region: 6972-7033
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000878
Family Spectrin repeat 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000019415
Domain Number - Region: 3321-3430
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000403
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 977-1127
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00396
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number - Region: 3571-3684
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00903
Family Spectrin repeat 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019415   Gene: ENSGGOG00000022359   Transcript: ENSGGOT00000033654
Sequence length 7476
Comment pep:known_by_projection chromosome:gorGor3.1:6:58011211:58283781:-1 gene:ENSGGOG00000022359 transcript:ENSGGOT00000033654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRKHVNDLYEDLRDGHNLISLLEVLSGDTLPREKGRMRFHRLQNVQIALDYLKRRQVKLV
NIRNDDITDGNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQATEGYAGI
RCENFTTCWRDGKLFNAIIHKYRPPLLLFNTGAFLSNLADLESPFFISLKVECIGVCRDI
LWKPSVVCCANIPYSSTFLTFILNLSDSFPQFPEGSKSKGAGEDVEVKWIEYQNMVNYLI
QWIRHHVTTMSERTFPNNPVELKALYNQYLQFKETEIPPKETEKSKIKRLYKLLEIWIEF
GRIKLLQGYHPNDIEKEWGKLIIAMLEREKALRPEVERLEMLQQIANRVQRDSVICEDKL
ILARNALQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQ
RVAKLRDEIMALRNECSSVYSKGRILTAEQTKLMISGITQSLNSGFAQTLHPSLTSGLTQ
SLTPSLTSSSMTSGLSSGMTSRLTPSATPAYTPGFPSGLVPNFSSGVEPNSLQTLKLMQI
RKPLLKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENHKNV
HRAIEEFESSLKEAKISEIQMTAPLKLTYAEKLHRLESQYAKLLNTSRNQERHLDTLHNF
VSRATNELIWLNEKEEEEVAYDWSERNTNIARKKDYHAELMRELDQKEENIKSVQEIAEQ
LLLENHPARLTIEAYRAAMQTQWSWILQLCQCVEQHIKENTAYFEFFNDAKEATDYLRNL
KDAIQRKYSCDRSSSIHKLEDLVQESMVLIQNLLQYKSTIASLMGKAKTIIQLKPRNSDC
PLKTSIPIKAICDYRQIEITIYKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFTVPPP
NKEAVDLANRIEQQYQNVLTLWHESHINMKSVVSWHYLINEIDRIRASNVASIKTMLPGE
HQQVLSNLQSRFEDFLEDSQESQVFSGSDITQLEKEVNVCKQYYQELLKSAEREEQEESV
YNLYISEVRNIRLRLENCEDRLIRQIRTPLERDDLHESVFRITEQEKLKKELERLKDDLG
TITNKCEEFFSQAAASSSVPTLRSELNVVLQNMNQVYSMSSTYIDKLKTVNLVLKNTQAA
EALVKLYETKLCEEEAVIADKNNIENLISTLKQWRSEVDEKRQVFHALEDELQKAKAISD
EMFKTYKERDLDFDWHKEKADQLVERWQNVHVQIDNRLRDLEGIGKSLKYYRDTYHPLDD
WIQQVETTQRKIQENQPENSKTLATQLNQQKMLVSEIEMKQSKMDECQKYAEQYSATVKD
YELQTMTYRAMVDSQQKSPVKRRRMQSSADLIIQEFMDLRTRYTALVTLMTQYIKFAGDS
LKRLEEEEKSLEEEKKEHVEKAKELQKWVSNISKTLKDAEKAGKPPFSKQKISSEEISTK
KEQLSEALQTMQLFLAKHGDKMTDEERNELEKQVKTLQESYNLLFSESLKQLQESQTSGD
VKVEEKLDKVIAGTIDQTTGEVLSVFQAVLRGLIDYDTGIRLLETQLMISGLISPELRKC
FDLKDAESHGLIDEQILCQLKELNKAKEIISAASPTTIPVLDALAQSMITESMAIKVLEI
LLSTGSLVIPATGEQLTLQKAFQQNLVSSALFSKVLERQNMCKDLIDPCTSEKVSLIDMV
QRSTLQENTGMWLLPVRPQEGGRITLKCGRNISILRAAHEGLIDRETMFRLLSAQLLSGG
LINSNSGQRMTVEEAVREGVIDRDTANSILTYQVQTGGIIQSNPAKRLTVDEAVQCDLIT
SSSALLVLEAQRGYVGLIWPHSGEIFPTSSSLQQELITNELAYKILNGRQKIAALYIPES
SQVIGLDAAKQLGIIDNNTASILKNIILPDKMPDLGDLEACKNGRRWLSFCKFQPSTVHD
YRQEEDVFDGEEPVTTQTSEQTKKLFLSYLMINSYMDANTGQRLLLYDGDLDEAVGMLLE
GCHAEFDGNTAIKECLDVLSSSGVFLNNASGREKDECTATRSSFNKCHCGEPEHEETPEN
RKCAIDEEFNEMRNTVINSEFSQSGKLASTISIDPKVNSSPSVCVPSLISYLTQTELADI
SMLRSDSENILTNYGNQSRVETNERANECSHSKNIQNFPSDLIENPIMKSKMSKFCGMDE
TENEDNTNRDSPIFDYSPRLSALLSHDKLMHSQGSFNDTHTPESNGNKWEAPTLSFSDKT
MLSGQRIGEKFQDQFLGIAAINISLPGEQYGQKSLNMISSNPQVQYHNDKYISNTSDEDE
KTHPGFQQMPEDKEDESEIEEYSCAVTPGGDTDNAIVSLTCATPLLDETISASDYETSLL
NDQQNNTGTDTDSDDDFYDTPLFEDDDHDSLLLDGDDRDCLHPEDYDTLQEENDETASPA
DVFYDVSKENENSMVPQGALVGSLSVKNKAQCLQDFLMDTEKDELDSGEKIHLNPVGSDK
VNGQSLETGSERECTNILEGDESDSLTDYDIVGGKESFTASLKFDDSGSWRGRKEEYVTG
QEFHSDTDHLDSMQSEESYGDYIGGGIRDENGKPRCQNVAEDTDIQLCASILNENSDENE
NINTMILLDKMHSCSSLEKQQRVNVVQLASPSENSLVTEKSNLPEYTTEIVGKSKENLLN
HEMVLKDVLPPIIKDTESEKTFGPASISHNNNNISSTSELGTDLANTKVKLIQGSELPEL
TDSVKGKDEYFKNMTPKVDSYLDHIICTEPDLIGKPAEESHLSSIASVTDKNPQGNGSDL
IKGRDGRSDILIEDETSIQKMYLGEGEVLVEGLVEEENRHLKLLPGKNTRDSFKLINSQF
PFPQITNNEELNQKGSLKKATVTLKDEPNNLQIIVSKSPVQFENLEEIFDTSVSKEISDD
ITSDITSWEGNTHFEKESFTDGPEKELDLFTYLKHCAKNIKAKDVAKPNEDVPSHVLITA
PPMKEHLQLGVNNTKEKSTSTQKDSPLNDMIQSNDLCSKESISGGGTEISQFTPESIEGI
LSILSRKHVEDVGKNDFLQSERCANGLGNDNSSNTLNTDYSFLEINNKKERIEQQLPKEQ
ALSPRSQEREVQIPELSQVFVEDVKDILKSRLKKEGHMNPQEVEEPSACADRITTSQLVN
EASTVLSDSQMSDSSGVSPMTNSSELKPESRDDPFCIGNLKSELLLNILKQDQHSQKITG
VFELMRELTHMEYDLEKRGITSKVLPLQLEHIFYKLLADGYSEKIEHVGDFNQKACSTSE
MTEEKPHILGDIKSKEGNHYSPNLETVKEIGLESSTVCASTLPRDEKLEDLCNDFPSHLE
CTSGSKEMASGDSSTEQFSSELQQCLQHTEKMHEYLTLLQDMKPPLDNQESLDNNLEALK
NQLRQLETFELGLAPIAVILRKDMKLAEEFLKSLPSDFPRGHVEELSISHQSLKTAFSSL
SNVSSERTKQIMLAIDSEMSKLAVSHEELLHKLKSFSDWVSEKSKSVKDIEIVNVQDSEY
VKKRLEFLKNVLKDLGHTKMQLETTAFDVQFFISEYAQDLSPNQSKQLLRLLNTTQKCFL
DVQESVTTQVERLETQLHLEQDLDDQKIVAERQQEYKEKLQGICDLLTQTENRLIGHQEA
FMIGDGTVELKKYQSEQEELQKDMQGSAQALAEVVKNTENFLKENGEKLSREDKALIEQK
LNEAKIKCEQLNLKAEQSKKELDKVVTTAIKEETEKVAAVKQLEESKTKIENLLDWLSNV
DKDSERAGTKHKQVIEQNGTHFQEDDGKSAIGEEDEVNGNLLETDVDGQVGTTQENLNQQ
YQKVKAQHEKIISQHQAVIIATQSAQVLLEKQGQYLSPEEKEKLQKNMKELKAHYETALA
ESEKKMKLTHSLQEELEKFDADYTEFEHWLQQSEQELENLEAGADDINGLMTKLKRQKSF
SEDVISHKGDLRYITISGNRVLEAAKSCSKRDGGKVDTSATHREVQRKLDHATDRFRSLY
SKCNVLGNNLKDLVDKYQHYEDASCGLLAGLQACEATASKHLSEPIAVDPKNLQRQLEET
KALQGQISSQQVAVEKLKKTAEVLLDARGSLLPAKNDIQKTLDDIVGRYEDLSKSVNERN
EKLQITLTRSLSVQDGLDEMLDWMGSVESSLKEQGQVPLNSTALQDIISKNIMLEQDIAG
RQSSINAMNEKVKKFMETTDPSTASSLQAKMKDLSARFSEASHKHKETLAKMEELKTKVE
LFENLSEKLQTFLETKTQALTEVDVPGKDVTELSQYMQESTSEFLEHKKHLEVLHSLLKE
ISSHGLPSDKALVFEKTNNLSKKFKEMEDTIKEKKEAVTSCQEQLDAFQVLVKSLKSWIK
ETTKKVPIVQPSFGAEDLGKSLEDTKKLQEKWSLKTPEIQKVNNSGISLCNLISAVTTPA
KAIAAVKSGGAVLNGEGTATNTEEFWANKGLTSIKKDMTDISHGYEDLGLLLKDKIAELN
TKLSKLQKAQEESSAMMQWLQKMNKTATKWQQTPAPTDTEAVKTQVEQNKSFEAELKQNV
NKVQELKDKLTELLEENPDTPEAPRWKQMLTEIDSKWQELNQLTIDRQQKLEESSNNLTQ
FQTVEAQLKQWLVEKELMVSVLGPLSIDPNMLNTQRQQVQILLQEFATRKPQYEQLTAAG
QGILSRPGEDPSLHGIVKEQLAAVTQKWDSLTGQLSDRCDWIDQAIVKSTQYQSLLRSLS
DKLSDLDNKLSSSLAVSTHPDAMNQQLETAQKMKQEIQQEKKQIKVAQALCEDLSALVKE
EYLKAELSRQLEGILKSFKDIEQKAENHVQHLQSACASSHQFQQMSRDFQAWLDTKKEEQ
NKSHPISAKLDVLESLIKDHKDFSKILTAQSHIYEKTIAEGENLLLKTQGSEKAALQLQL
NTIKTNWDTFNKQVKERENKLKESLEKALKYKEQVETLWPWIDKCQNNLEEIKFCLDPAE
GETSIAKLKSLQKEMDQHFGMVELLNNTANSLLSVCEIDKEVVTDENKSLIQKVDMVTEQ
LHSKKFCLENMTQKFKEFQEVTKESKRQLQCAKEQLDIHDSLGSQAYSNKYLTMLQTQQK
SLQALKHQVDLAKRLAQDLVVEASDSKGTSDVLLQVETIAQEHSTLSQQVDEKCSFLETK
LQGIGHFQNTIREMFSQFAEFDDELDSMAPVGRDAETLQKQKETIKAFLKKLEALIASND
NANKTCKMMLATEETSPDLVGIKRDLEALSKQCNKLLDRAQAREEQVEGTIKRLEEFYSK
LKEFSILLQKAEEHEESQGPVGMETETINQQLNMFKVFQKEEIEPLQGKQQDVNWLGQGL
IQSAAKSTSTQDLEHDLDDVNARWKTLNKKVAQRAAQLQEALLHCGRFQDALESLLSWMV
DTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRKSTVEVIKREGEKIATTAEPADKV
KILKQLSLLDSRWEALLNKAETRNRQLEGISVVAQQFHETLEPLNEWLTTIEKRLVNCEP
IGTQASKLEEQIAQHKALEDDIINHNKHLHQAVSIGQSLKVLSSREDKDMVQSKLDFSQV
WYIEIQEKSHSRSELLQQALCNAKIFGEDEVELMNWLNEVHDKLSKLSVQDYSTEGLWKQ
QSELRVLQEDILLRKQNVDQALLNGLELLKQTTGDEVLIIQDKLEAIKARYKDITKLSTD
VAKTLEQALQLARRLHSTHEELCTWLDKVEVELLSYETQVLKGEEASQAQMRQKELKKEA
KNNKALLDSLNEVSSALLELVPWRAREGLEKMVAEDNERYRLVSDTITQKVEEIDAAILR
SQQFDQAADAELSWITETEKRLMSLGDIRLEQDQTSAQLQVQKTFTMEILRHKDIIDELV
KSGHKIMTACSEEEKQSMKKKLDKVLKNYDTICQINSERYLQLERAQSLVNQFWETYEEL
WPWLTETQSIISQLPAPALEYETLRQQQEEHRQLRELIAEHKPHIDKMNKTGPQLLELSP
GEGFSIQEKYVAADTLYSQIKEDVKKRAVALDEAISQSTQFHDKIDQILESLERIVERLR
QPPSISAEVEKIKEQISENKNVSVDMEKLQPLYETLKQRGEEMIARSGGTDKDISAKAVQ
DKLDQMVFIWENIHTLVEEREAKLLDVMELAEKFWCDHMSLVVTIKDTQDFIRDLEDPGI
DPSVVKQQQEAAETIREEIDGLQEELDIVINLGSELIAACGEPDKPIVKKSIDELNSAWD
SLNKAWKDRIDKLEEAMQAAVQYQDGLQAVFDWVDIAGGKLASMSPIGTDLETVKQQIEE
LKQFKSEAYQQQIEMERLNHQAELLLKKVTEESDKHTVQDPLMELKLIWDSLEERIINRQ
HKLEGALLALGQFQHALDELLTWLTHTEGLLSEQKPVGGDPKAIEIELAKHHVLQNDVLA
HQSTVEAVNKAGNDLIESSAGEEASNLQNKLEVLNQRWQNVLEKTEQRKQQLDGALRQAK
GFHGEIEDLQQWLTDTERHLLASKPLGGLPETAKEQLNVHMEVCAAFEAKEETYKSLMQK
GQQMLARCPKSAETNIDQDINNLKEKWESVETKLNERKTKLEEALNLAMEFHNSLQDFIN
WLTQAEQTLNVASRPSLILDTVLFQIDEHKGKVFANEVNSHREQIIELDKTGTHLKYFSQ
KQDVVLIKNLLISVQSRWEKVVQRLVERGRSLDDARKRAKQFHEAWSKLMEWLEESEKSL
DSELEIANDPDKIKTQLAQHKEFQKSLGAKHSVYDTTNRTGRSLKEKTSLADDNLKLDDM
LSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAEDQPVHGDI
DLVMNLIDNHKAFQKELGKRTSSVQALKRSARELIEGSRDDSSWVKVQMQELSTRWETVC
ALSISKQTRLEAALRQAEEFHSVVHALLEWLAEAEQTLRFHGVLPDDEDALRTLIDQHKE
FMKKLEEKRAELNKATTMGDTVLAICHPDSITTIKHWITIIRARFEEVLAWAKQHQQRLA
SALAGLIAKQELLEALLAWLQWAETTLTDKDKEVIPQEIEEVKALIAEHQTFMEEMTRKQ
PDVDKVTKTYKRRAADPSSLQSHIPVLDKGRAGRKRFPASSLYPSGSQTQIETKNPRVNL
LLREFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILSSKFPTS
RLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAYKPITDADKIEDEVTRQVAKCKCAKR
FQVEQIGDNKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRVHH
HGSKMLRSESNSSITTTQPTIAKGRTNMELREKFILADGASQGMAAFRPRGRRSRPSSRG
ASPNRSTSVSSQAAQAASPQVPATTTPKGTPIQGSKLRLPGYLSGKGFHSGEDSGLITTA
AARVRTQFADSKKTPSRPGSRAGSKAGSRASSRRGSDASDFDISEIQSVCSDVETVPQTH
RPTPRAGSRPSTAKPSKIPTPQRKSPASKLDKSSKR
Download sequence
Identical sequences ENSGGOP00000019415 ENSGGOP00000019415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]