SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019444 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019444
Domain Number 1 Region: 19-115
Classification Level Classification E-value
Superfamily Immunoglobulin 2.85e-46
Family V set domains (antibody variable domain-like) 0.0000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019444   Gene: ENSGGOG00000027230   Transcript: ENSGGOT00000028317
Sequence length 116
Comment pep:novel chromosome:gorGor3.1:16:34112978:34114669:1 gene:ENSGGOG00000027230 transcript:ENSGGOT00000028317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLVYLLLLLYITKLSVQCEVHLVQSGGGLVQPGGSLRLSCAGSGFTFSSHAMHWVRQAPG
KGLEWVSAIGTGGGTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDMAVYYCARD
Download sequence
Identical sequences ENSGGOP00000019444 ENSGGOP00000019444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]