SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019449 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019449
Domain Number 1 Region: 49-134
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000103
Family Canonical RBD 0.0000113
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000019449
Domain Number - Region: 138-164
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0222
Family CCCH zinc finger 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019449   Gene: ENSGGOG00000000142   Transcript: ENSGGOT00000034728
Sequence length 659
Comment pep:known_by_projection chromosome:gorGor3.1:7:133595107:133655353:-1 gene:ENSGGOG00000000142 transcript:ENSGGOT00000034728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCLKPYPEDPAVYKPLSQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVV
GLSQRLADPEVLKRPEYFGKFGKIHKVVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQ
CVNNVVVDGRTLKASLGTTKYCSYFLKNMQCPKPDCMYLHELGDEAASFTKEEMQAGKHQ
EYEQKLLQELYKLNPNFLQLSTGSVDKNKNKVTPLQRYDTPIDKPSDSLSIGNGDNSQQI
SNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSGLPPF
PSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKA
LADLIEKELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQ
RFPQFQQHRAVYNSFSFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNT
GLGGIPVADNSSSVESLNMKEWQDGLRALLPNININFGGLPNSSSPSNANHSAPTSNTAT
TDSLSWDSPGSWTDPAIITGIPASSGNSLDSLQDDNPPHWLKSLQALTEMDGPSAAPSQT
HHSAPFSTQIPLHRASWNPYPPPSNPSSFHSPPPGFQTAFRPPSKTPTDLLQSSTLDRH
Download sequence
Identical sequences ENSGGOP00000019449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]