SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019488 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019488
Domain Number 1 Region: 199-372,438-467,545-639,686-721
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.4e-30
Family WD40-repeat 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000019488
Domain Number - Region: 97-244
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000863
Family YVTN repeat 0.06
Further Details:      
 
Domain Number - Region: 1201-1361
Classification Level Classification E-value
Superfamily ARM repeat 0.0053
Family PBS lyase HEAT-like repeat 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019488   Gene: ENSGGOG00000002376   Transcript: ENSGGOT00000032554
Sequence length 1622
Comment pep:known_by_projection chromosome:gorGor3.1:8:144289918:144299764:1 gene:ENSGGOG00000002376 transcript:ENSGGOT00000032554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAEVWEAEGYNLVLDSDLYDADGYDVPDPGLLTEKNELTFTEPSQVLPFLTSSQQWQSL
TPRARARRLWLLLRTSLDEVVEKEKRAELRVARLTHGLEPLRRLEVAAGLRSVAQDPVGG
RFVVLDRAGRLHLHKEDGWAQETLLAPVGLTGLVTVLGPLGAVGRFVGWGPAGLAILRPN
FSLLWLSEQGVGRAPGWAPTCCLPVPDLRLLLVAEMNSSLALWQFRSGGRRLVLRGSPLH
PPPSPTGRLMRLAVAPVPPHHVLRCFAAYGSAVLTFDLHAWTLVDVRRDLHKTTISDLAY
CEEVEAMVTASRDSTVKVWEADWQIRMVFVGHTGPVTAMTVLPNTTLVLSASQDGTLRTW
DLQAAAQVGEVALGFWGQDKLSRRVGRLLAPVRPGWPVLSLCASSMQLWRVRELYSPLAQ
LPAKVLHVQVAPALPAPAHQSLPTRLVCACADGSVYLLSAATGRIVSSLLLEPEDCAAAV
AYCLPREALWLLTRAGHLVRANAARCPMSVLHRVCPPPPPAPQPCCLHLYSHLTDLGGAF
SSWEIVRQHWGELRCSSVACAWKNKNRYLPVVGHTDGTLSVLEWLSSKTVFQREAHSPGP
VVAIASTWNSIVSSGGDLTVKMWRVFPYAEESLSLLRTFSCCYPAVALCALGRRVTAGFE
DPDSATYGLVQFGLGDSPRLDHRPQDDPTDHITGLCCCPTLKLYACSSLDCTVRIWTAEN
RLLRLLQLNGAPQALAFCSNSGDLVLALGSRLCLVSHRLYLPTSYLVKKMCRKAPDVVDD
PPLPLMSQESLTSAQLQRLTNLHGAASLSEALPLIHRRRATSQHLVPKEDLDALVARDRD
LQQLRLGLVVPAAQPPPSWQQRQEGFDNYLRLIYGSGLLGMQSGRESQQWSAGTLTVERE
TQDVCALPQAAHCLARAKVSTAAQTVPTALSPQDLGALGQHFSQSPRVTVPIPPTHRRVH
SKASQLLARSSLSHYLGVSLDLQLQLEQLRGRTTMALDLPSSHLQCRIPLLPKRWDKEPL
CSLRGFFPATVQPHKHCLRPICFPGYVPNSAVLQQMWLNAEPGASQDALWLWRPRPSQAQ
WQRKLLQWMGEKPGEEGEEEEKEEEEEKEDEEPDRALVSLSPHSNQQLDSWELEDQSAVD
WTQEPRRRSCKAARTHPHPWHHHESLLLDEHYGHLPKFLHFFIYQTWFKKLFPIFSLQAY
PEAGTVEGLASLLVALLEKTTWVDRVHILQVLLRLLPNISSDLQGQLQGLLVHLLNLDQP
PSLQDQTQKKFVILALQLLLACSLESWDVVLELMSYFLYSPVHCRPELKKLLHGLGLQDP
EDFLFKEMMTWVQGPDLDSKASLRTCCRQKLEDMIQQLQETPLQTSVVSGAPTRASVIPS
GTSWSPSSIFGRLSQVSEVPLMMVSPAEPHSLAPELQAQRTLAPTRSWGTPQLHLRVLSE
TLKSFCLEPEARLHPAGPAQLPGEPPPLEETDWSHSQLLDLGPIDALNFFCEQLRAQQRS
SLQEEAAHPHPPVPDTVAPVPDMVVPPPREHWYHPILRLQEAKPQRSARSAMRLRGPMLS
RLCAGRTLDGPIRTLKLPLPRVEPQPFPLDWPTPPRPLPPRLLQPALQRYFLPADADPDT
YS
Download sequence
Identical sequences ENSGGOP00000019488 ENSGGOP00000002341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]