SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019546 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019546
Domain Number 1 Region: 40-230
Classification Level Classification E-value
Superfamily Aquaporin-like 1.22e-27
Family Aquaporin-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019546   Gene: ENSGGOG00000027009   Transcript: ENSGGOT00000025691
Sequence length 230
Comment pep:novel chromosome:gorGor3.1:2b:130134648:130137098:1 gene:ENSGGOG00000027009 transcript:ENSGGOT00000025691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLNVSLSFFFATFALCEAARRASKALLPVGAYEVFAREAMRTLVELGPWAGDFGPDLL
LTLLFLLFLAHGVTLDGASANPTVSLQEFLMAEESLPGTLLKLAAQGLGMQAACTLTRLC
WAWELSDLHLLQSLMAQSCSSALRTSVPHGALVEAACAFCFHLTLLYLRHSPPAYSVPAV
ALLVTVTAYTAGPFTSAFFNPALAASVTFACSGHTLLEYVQVYWLGPLTG
Download sequence
Identical sequences ENSGGOP00000019546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]