SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019567 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019567
Domain Number 1 Region: 41-188
Classification Level Classification E-value
Superfamily EF-hand 2.86e-33
Family Calmodulin-like 0.00000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019567   Gene: ENSGGOG00000009722   Transcript: ENSGGOT00000024087
Sequence length 190
Comment pep:known_by_projection chromosome:gorGor3.1:5:36898871:36913188:-1 gene:ENSGGOG00000009722 transcript:ENSGGOT00000024087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLCQRSQQDSMAPKKPEPKKEAATEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTP
TGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNK
EQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINY
EAFVKHIMSG
Download sequence
Identical sequences ENSGGOP00000019567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]