SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019569 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000019569
Domain Number - Region: 57-89
Classification Level Classification E-value
Superfamily EF-hand 0.0657
Family EF-hand modules in multidomain proteins 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019569   Gene: ENSGGOG00000005037   Transcript: ENSGGOT00000032525
Sequence length 604
Comment pep:known_by_projection chromosome:gorGor3.1:3:128918743:128961397:1 gene:ENSGGOG00000005037 transcript:ENSGGOT00000032525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPVSAGAEAGMEGAGGDPYRRPARRTQWLLSALAHHYGLDRGVENEIVVLATGLDQYLQ
EVFHHLDCRGAGRLPRADFRALCAVLGLRAEGATAAGQAAGDANSRDVTPGDAAAELATD
GDSDTDEEARLALRAEPPELTFRQFHARLCGYFGTRAGPRLPRGALSEHIETQIRLRRPR
RRRRPPCAPGPDSGPDCERVARLEEENSSLRELVEDLRAALQSSDARCLALQVGLWKSQA
STHEMGYGGPEAAVLELRQAQELRQVQGALAAAEARAGRLRRGQAEVRRRAEEARQVVLR
SLDRVRELEALAQQVPGLQRWVRRLEAELQRYRSEDSQLPTPQLASPEPGDKSNEPEDAG
TRDPDPTPEGAWQSDSSSGSRALDEVDEQLFRSVEGQAASDEEEVEEERWQEEKKTPAAE
AKTLLARLSSCRGRCDDQTAEKLMTYFGHFGGADHAHTLGELEACIAMLVEQLRTQGCGG
RTLGTSGEEAELQQKVEENEHLRLELQMVETERVRLSLLEEKLVDVLQLLQRLRDLNISK
RALGKILLSTLDAFRDPTHEGRPSPAAILDALHQALAACQLLRRQPSAPASAAAALTNPL
LVSC
Download sequence
Identical sequences ENSGGOP00000004934 XP_004036313.1.27298 ENSGGOP00000019569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]