SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019593 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019593
Domain Number 1 Region: 56-280,314-416
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.96e-97
Family Calpain large subunit, catalytic domain (domain II) 0.000000108
Further Details:      
 
Domain Number 2 Region: 421-575
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 8.63e-55
Family Calpain large subunit, middle domain (domain III) 0.00000177
Further Details:      
 
Domain Number 3 Region: 633-815
Classification Level Classification E-value
Superfamily EF-hand 2.44e-52
Family Penta-EF-hand proteins 0.00000502
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019593   Gene: ENSGGOG00000012597   Transcript: ENSGGOT00000024326
Sequence length 816
Comment pep:known_by_projection chromosome:gorGor3.1:15:21084414:21135222:1 gene:ENSGGOG00000012597 transcript:ENSGGOT00000024326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTVISASVAPRTAAEPRSPGPVPHPAQSKATEAGGGNPSGIYSAIISRNFPIIGVKEKT
FEQLHKKCLEKKVLYVDPEFPPDETSLFYSQKFPIQFVWKRPPEICENPRFIIDGANRTD
ICQGELGDCWFLAAIACLTLNQHLLFRVIPHDQSFIENYAGIFHFQFWRYGEWVDVVIDD
CLPTYNNQLVFTKSNHRNEFWSALLEKAYAKKRHVPLYMHIVGDQFQATTALTKNIKFKS
RNEDLHRRPFHVVSQLKSSTPDANNGFLILRGPERRGRGTVTHPTSQHPHCSLMVRTEPS
QGDQLVWTIIPVQYETRMACGLVRGHAYSVTGLDEVLFKGEKVKLVRLRNPWGQVEWNGS
WSDRSTMLGYFSAQERRCLQTWPFSLVNQRMSYEDFIYHFTKLEICNLTADALQSDKLQT
WTVSVNEGRWVRGCSAGGCRNFPGGADTFWTNPQYRLKLLEEDDDPDDSEVICSFLVALM
QKNRRKDRKLGASLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINMREVSQ
RFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRPVKKKKTKVGVWV
ESMRGHHTPSDLVLAFLVVPGGDGSITGVLQVLVLAQTSDQESEEQQQFRNIFKQIAGDD
MEICADELKKVLNTVVNKHKDLKTHGFTLESCRSMIALMDTDGSGKLNLQEFHHLWNKIK
AWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICC
FVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA
Download sequence
Identical sequences ENSGGOP00000012299 ENSGGOP00000019593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]