SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019594 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019594
Domain Number 1 Region: 156-345
Classification Level Classification E-value
Superfamily HIT-like 2.21e-67
Family mRNA decapping enzyme DcpS C-terminal domain 0.0000000071
Further Details:      
 
Domain Number 2 Region: 42-156
Classification Level Classification E-value
Superfamily mRNA decapping enzyme DcpS N-terminal domain 0.0000000000144
Family mRNA decapping enzyme DcpS N-terminal domain 0.0000472
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019594   Gene: ENSGGOG00000005028   Transcript: ENSGGOT00000029930
Sequence length 347
Comment pep:known_by_projection chromosome:gorGor3.1:11:124495739:124540946:1 gene:ENSGGOG00000005028 transcript:ENSGGOT00000029930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADAAPQLGKRKRELDVEEAHAASTEEKEAGVGNGTCAPVRLPFSGFRLQKVLRESARDK
IIFLHGKVPGGNPEEIKGDGREGQVILAEVPKGIDTLKKIFLGAPPPEVQLQNVNNSVKQ
TYDLRPKSHIPRNLVYVKTTVVYPATEKHLQKYLRQDLRLIRETGDDYRNITLPHLESQS
LSIQWVYNILDKKAEADRIVFENPDPSDGFVLIPDLKWNQQQLDDLYLIAICHRRGIRSL
RDLTPEHLPLLRNILHQGQEAILQRYRMKGDHLRVYLHYLPSYYHLHVHFTALGFEAPGS
GVERAHLLAEVIENLECDPRHYQQRTLTFALRADDPLLKLLQEAQQS
Download sequence
Identical sequences ENSGGOP00000004927 ENSGGOP00000019594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]