SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019683 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019683
Domain Number 1 Region: 630-913
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.94e-99
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000282
Further Details:      
 
Domain Number 2 Region: 923-1230
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.79e-81
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000586
Further Details:      
 
Domain Number 3 Region: 388-550
Classification Level Classification E-value
Superfamily Fibronectin type III 4.98e-17
Family Fibronectin type III 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019683   Gene: ENSGGOG00000025823   Transcript: ENSGGOT00000032261
Sequence length 1310
Comment pep:known_by_projection chromosome:gorGor3.1:1:178540290:178605543:1 gene:ENSGGOG00000025823 transcript:ENSGGOT00000032261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVCYVSDLAWGFKKDFCFYFAGQSPTPSPTGLTTAKMPSVPLSSDPLPTHTTAFSPASTF
ERENDFSETTTSLSPDNTSTQVSPDSLDNASAFNTTGVSSVQTPHLPTHADSQTPSAGTD
TQTFSGSAASAKLNPTPGSNAISDVPGERSTASTFPTDPVSPLTTTLSLAHHSSAALPAR
TSNTTITANTSDAYLNASETTTLSPSGSAVISTTTIATTPSKPTCDEKYANITVDYLYNK
ETKLFTAKLNVNENVECGNNTCTNNEVHNLTECKNMSVSISHNSCTAPDKTLLLDVPPGV
EKFQLHDCTQVEKADTTICLKWKNIETFTCDTQNITYRFQCGNMTFDKKEIKLENLEPEH
EYKCDSEILYNNHKYTNASKIIKTDFGTPGEPQIIFCRSEAAHQGVITWNPPQRSFHNFT
LCYINETEKKCLNLDKNLNNYDLQNLKPYTKYDLSLHAYITAKVQRNGTAATCHLITKSA
PPSQVWNMTISMTSDNSMHVKCRPPRDRNGPHERYHLEVEAGNTLVRNESHKNCDFRVKD
LQYSTNYTFKSFVESISHKTHKLKLPYSLSYDNSKALIAFLAFLIIVTSIALLVVLYKIY
DLHKKRSCNLDEQQELVERDDEKQLMNVEPIHADILLETYKRKIADEGRLFLAEFQSIPR
VFSKFPIKEARKPFNQNKNRYVDILPYDYNRVELSEINGDAGSNYINASYIDGFKEPRKY
IAAQGPRDETVDDFWRMIWEQKATVIVMVTRCEEGNRNKCAEYWPSMEEGTRAFGDVVVK
INQHKRCPDYIIQKLNIVNKKEKATGREVTHIQFTSWPDHGVPEDPHLLLKLRRRVNAFS
NFFSGPIVVHCRFASAGVGRTGTYIGIDAMLEGLEAENKVDVYGYVVKLRRQRCLMVQVE
AQYILIHQALVEYNQFGETEVNLSELHPYLHNMKKRDPPSEPSPLEAEFQRLPSYRSWRT
QHIGNQEENKSKNRNSNVIPYDYNRVPLKHELEMSKESEHDSDESSDDDSDSEEPSKYIN
ASFIMSKKSYWKPEVMIAAQGPLKETIGDFWQMIFQRKVKVIVMLTELKHGDQEICAQYW
GEGKQTYGDIEVDLKDTDKSSTYTLRVFELRHSKRKDSRTVYQYQYTNWNVEQLPAEPKE
LISMIQVLKQKLPQKNSSEGNKHHKSTPLLIHCRDGSQQTGIFCALLNLLESAETEEVVD
IFQVVKALRKARPGMVSTFEQYQFLYDVIASTYPAQNGQVKKNNHQEDKIEFDNEVDKVK
QDANCVNPLGAPEKLPEAKEQAEGSEPTSGTEGPEHSVNGPASPALNQGS
Download sequence
Identical sequences ENSGGOP00000019683 ENSGGOP00000019683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]