SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019706 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019706
Domain Number 1 Region: 41-263
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 0.00000366
Family Glycerol-3-phosphate (1)-acyltransferase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019706   Gene: ENSGGOG00000006317   Transcript: ENSGGOT00000025153
Sequence length 410
Comment pep:known_by_projection chromosome:gorGor3.1:2a:75906355:75909555:-1 gene:ENSGGOG00000006317 transcript:ENSGGOT00000025153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELPSGPGPERLFDSHRLPGDCFLLLALLLYAPVGFCLLVLRLFLGIHVFLVSCALPDSV
LRRFVVRTMCAVLGLVARQEDSGLRDHSVRVLISNHVTPFDHNIVNLLTTCSTPLLNSPP
SFVCWSRGFMEMNGRGELVESLKRFCASTRLPPTPLLLFPEEEATNGREGLLRFSSWPFS
IQDVVQPLTLQVQRPLVSVTVSDASWVSELLWSLFVPFTVYQVRWLRPVHRQLGEANEEF
ALRVQQLVAKELGQTGTRLTPADKAEHMKRQRHPRLRPQSAQSSFPPSPGPCPDVQLATL
AQRVKEVLPHVPLGVIQRDLAKTGCVDLTITNLLEGAVAFMPEDITKGTQSLPTASASKF
PSSGPVTPQPTALTFAKSSWARQESLQERKQALYEYARRRFTERRAQEAD
Download sequence
Identical sequences G3RV77
ENSGGOP00000019706 XP_004029526.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]