SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019718 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000019718
Domain Number - Region: 90-169
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.0243
Family RecO C-terminal domain-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019718   Gene: ENSGGOG00000002858   Transcript: ENSGGOT00000031808
Sequence length 217
Comment pep:known_by_projection chromosome:gorGor3.1:11:66633632:66662214:-1 gene:ENSGGOG00000002858 transcript:ENSGGOT00000031808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSQDIFDAIVMADERFHGEGYREGYEEGSSLGVMEGRQHGKLHGAKIGSEIGCYQGFA
FAWKCLLHSCTTEKDSRKMKVLESLIGMIQKFPYDDPTYDKLHEDLDKIRGKFKQVRALC
TFMFVFLSSAGNMPVTCWCWEAPRCNQKRTDPAARRPDPQTCASQDRLRCAPCTCHQPLA
FRYTQHPGLVPLPHHDRQSVPQGPRVVQTDAAATMVE
Download sequence
Identical sequences ENSGGOP00000019718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]