SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019747 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019747
Domain Number 1 Region: 28-276,344-375
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.54e-107
Family Type II chitinase 0.000000000155
Further Details:      
 
Domain Number 2 Region: 272-339
Classification Level Classification E-value
Superfamily Chitinase insertion domain 2.6e-23
Family Chitinase insertion domain 0.0000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019747   Gene: ENSGGOG00000011183   Transcript: ENSGGOT00000022520
Sequence length 376
Comment pep:known_by_projection chromosome:gorGor3.1:1:183202162:183212035:-1 gene:ENSGGOG00000011183 transcript:ENSGGOT00000022520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRRVTSPQKALLTAIPFLYSNGPGSAAKLVCYFTNWAQYRQGEARFLPKDVDPSLCTHLI
YAFAGMTNHQLSTIEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANN
RQTFVNSAIRFLRKYSFDGLDLDWEYPGSRGSPAVDKERFTALVQDLANAFQQEAQTSGK
ERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEES
GAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFT
KEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGA
MVWALDLDDFAGFSCN
Download sequence
Identical sequences ENSGGOP00000019747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]