SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019749 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019749
Domain Number 1 Region: 140-260
Classification Level Classification E-value
Superfamily R3H domain 7.98e-42
Family R3H domain 0.00000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019749   Gene: ENSGGOG00000009337   Transcript: ENSGGOT00000033118
Sequence length 815
Comment pep:known_by_projection chromosome:gorGor3.1:3:36625815:36781845:1 gene:ENSGGOG00000009337 transcript:ENSGGOT00000033118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEQGDLNQAIAEEGGTEQETATPENGIVKSESLDEEEKLELQNIQRRLEAQNQERRKSK
SGAGKGKLTRSLAVCEESSARPGGESLQDQESIHLQLSSFSSLQEEDKSRKDDSEREKEK
DKNKDKTSEKPKIRMLSKDCSQEYTDSTGIDLHEFLINTLKNNSRDRMILLKMEQEIIDF
IADNNNHYKKFPQMSSYQRMLVHRVAAYFGLDHNVDQTGKSVIINKTSSTRIPEQRFCEH
LKDEKGEESQKRFILKRDNSSIDKEDNQQNRMHPFRDDRRSKSIEEREEEYQRVRERIFA
HDSVCSQESLLVENSRLLEDSNICNETYKKRQLFRGNRDGSGRTSGSRQSSSENELKWSD
HQRAWSSTDSDSSNRNLKPAMTKTASFGGITVLTRGDSTSSTRSTGKLSKAGSESSSSAG
SSGSLSRTHPPLQSTPLVSGVAAGSPGCVPYPENGIGGQVAPSSTSYILLPLEAATGIPP
GSILLNPHTGQPFVNPDGTPAIYNPPTSQQPLRSAMVGQSQQQPPQQQPSPQPQQQVQPP
QPQMAGPLVTQRDDVATQFGQMTLSRQSSGETPEPPSGPVYPSSLMPQPAQQPSYVIAST
GQQLPTGGFSGSGPPISQQVLQPPPSPQGFVQQPPPAQMPVYYYPSGQYPTSTTQQYRPM
APVQYNAQRSQQMPQAAQQAGYQPVLSGQQGFQGLIGVQQPPQSQNVMNNQQGTPVQSVM
VSYPTMSSYQVPMTQGSQVLPQQSYQQPIMLPNQAGQGSLPATGMPVYCNVTPPTPQNNL
RLIGPHCPSSTVPVMSASCRTNCASMSNAGWQVKF
Download sequence
Identical sequences ENSGGOP00000009132 ENSGGOP00000019749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]