SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019798 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019798
Domain Number 1 Region: 244-500
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.11e-54
Family Voltage-gated potassium channels 0.00083
Further Details:      
 
Domain Number 2 Region: 76-179
Classification Level Classification E-value
Superfamily POZ domain 8.9e-31
Family Tetramerization domain of potassium channels 0.0000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019798   Gene: ENSGGOG00000013142   Transcript: ENSGGOT00000028368
Sequence length 551
Comment pep:known_by_projection chromosome:gorGor3.1:1:113134198:113146717:1 gene:ENSGGOG00000013142 transcript:ENSGGOT00000028368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGIGRGRAKPQRGPPPPPASSSSPPPLPPREQRPPQAGPAALLMISSVCVSSYRGLGEQA
SETCLKEEMAKRGVGKIIINVGGTRHETYRSTLRTLPGTRLAWLADPEAAVCGSSGGGGC
EFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELTFWGIDETDVEPCCWMTYRQHR
DAEEALDIFEPDGGGSGAGPSDEAGDDAGAGPERLGPHEGGAGHGAGSGGCRGWQPRMWA
LFEDPYSSRAARVAFASLFFILVSITTFCLETHEAFNIDGNVTEILRVGNITSVHFRREV
ETEPILTYIEGVCVLWFTLEFLVRIVCCPDTLDFVKNLLNIIDFVAILPFYLEVGLSGLS
SKAARDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIF
ATMIYYAERIGARPSDPRGNDHTDFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGAL
CALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKRKKHVPRPAQLESPMYCKSDLPPA
REEGMIERKRA
Download sequence
Identical sequences ENSGGOP00000019798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]