SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019802 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019802
Domain Number 1 Region: 625-815,1192-1347
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.08e-107
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000386
Further Details:      
 
Domain Number 2 Region: 413-530
Classification Level Classification E-value
Superfamily HSP20-like chaperones 2.09e-36
Family GS domain 0.000000642
Further Details:      
 
Domain Number 3 Region: 921-969
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.00000000279
Family MYND zinc finger 0.0085
Further Details:      
 
Domain Number 4 Region: 174-246
Classification Level Classification E-value
Superfamily HSP20-like chaperones 0.00000000506
Family GS domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019802   Gene: ENSGGOG00000014895   Transcript: ENSGGOT00000030871
Sequence length 1415
Comment pep:known_by_projection chromosome:gorGor3.1:3:50364519:50377014:-1 gene:ENSGGOG00000014895 transcript:ENSGGOT00000030871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRAGCQGPKRAGCGGLARLSVPCWRIWPQRVAKIAGPGRKRRSPDPDAVADPGALWLSTK
RLKMSGGASATGPRRGPPGLEDTTSKKKQKDRANQESKDGDPRKGGSGIPRVLVAFSPSH
LIGIQIGVWEMTFLFFFPSSSGSASTPQEEQTKEGACEDPHDLLATPPPELLLDWRQSAE
EVIVKLRVGVGPCVVRFAGGQQWGGVFYAEIKSSCAKVQTRKGSLLHLTLPKKVPMLTWP
SLLKKPLGTQELVPGLQCQENGQELSPIALEPGPEPHRAKQEARNQKRAQGRGEVGSGAG
PGAQAGPSAKRAVHLCRGPEGEGSRDDPGPRGDAPPFVADPATQAEADEQLCIPPLNPQT
CLLGSEENLAPLAGEKAVPPGNDPVSPAMVRSRNPGKDDCAKEEMAVAADAATLVDEPES
MVNLAFVKNDSYEKGPDSVVVHVYVKEICRDTSRVLFREQDFTLIFQTRDGNFLRLHPGC
GPHATFRWQVKLRNLIEPEQCTFCFTASRIDICLRKRQSQRWGGLEAPAARGAVGGAKVA
VPTGPTPLDSTPPGGAPHPLTGQEEARAVEKDKSKARSEDTGLDSVATRTPMEHVTPKPE
THLASPKPTCMVPPMPHSPVSGDSVCLPGFTGLVNLGNTCFMNSVIQSLSNTRELRDFFH
DRSFEAEINYNNPLGTGGRLAIGFAVLLRALWKGTHHAFQPSKLKAIVASKASQFTGYAQ
HDAQEFMAFLLDGLHEDLNRIQNKPYTETVDSDGRPDEVVAEEAWQRHKMRNDSFIVDLF
QGQYKSKLVCPVCAKVSITFDPFLYLPVPLPQKQKVLPVFYFAREPHSKPIKFLVSVSKE
NSTASEVLDSLSQSVHVKPENLRLAEVIKNRFHRVFLPSHSLDTVSPSDVLLCFELLSSE
LAKERVVVLEVQQRPQVPSVPISKCAACQRKQQSEDEKLKRCTRCYRVGYCNQLCQKTHW
PDHKGLCRPENIGYPFLVSVPASRLTYARLAQLLEGYARYSVSVFQPPFQPGRMALESQS
PGCTTLLSTGSLEAGDSERDPIQPPELQLVTLMAEGDTGLPRVWAAPDRGPVPSTSGISS
EMLASGPIEVGSLPAGERVSRPEAAVPGYQHPSEAMNAHTPQFFIYKIDSSNREQRLEDK
GDTPLELGDDCSLALVWRNNERLQEFVLVASKELECAEDPGSAGEAARAGHFTLDQCLNL
FTRPEVLAPEEAWYCPQCKQHREASKQLLLWRLPNVLIVQLKRFSFRSFIWRDKINDLVE
FPVRNLDLSKFCIGQKEEQLPSYDLYAVINHYGGMIGGHYTACARLPNDRSSQRSDVGWR
LFDDSTVTTVDESQVVTRYAYVLFYRRRNSPVERPPRAGHSEHHPDLGPAAEAAASQGLG
PGQAPEVAPTRTAPERFTLPVDRPAPTYSNMEEVD
Download sequence
Identical sequences ENSGGOP00000019802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]