SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019812 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019812
Domain Number 1 Region: 80-338
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.64e-28
Family RecA protein-like (ATPase-domain) 0.0015
Further Details:      
 
Domain Number 2 Region: 2-58
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 0.0000863
Family C-terminal domain of RNA polymerase alpha subunit 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019812   Gene: ENSGGOG00000009589   Transcript: ENSGGOT00000028670
Sequence length 346
Comment pep:known_by_projection chromosome:gorGor3.1:14:85729727:85742046:-1 gene:ENSGGOG00000009589 transcript:ENSGGOT00000028670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLDLLDLNPRIIAAIKKAKLKSVKEVLRFSGPDLKRLTNLSSPEVWHLLRTASLHLRGS
SILTALQLHQQKERFPAQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQL
CLAVQFPRQHGGLEAGEWPLFRGDSFPLRKWQAGSEGQSRLGTLVGKGTSHKRDVASQLF
FSHASRVDTLLECVNKKVPVLLSRGMARLVVIDSVAAPFRCEFDSQASAPRARHLQSLGA
ALRELSSAFQSPVLCINQVTEAMDEQGAAHRPLGFWDERVSPALGITWANQLLVRLLADR
LREEEAALGCPARTLRVLSAPHLPPSSCSYTISAEGVRGTPGTQSH
Download sequence
Identical sequences ENSGGOP00000009366 ENSGGOP00000019812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]