SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019828 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019828
Domain Number 1 Region: 30-67
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000127
Family LIM domain 0.00057
Further Details:      
 
Domain Number 2 Region: 2-29
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000119
Family LIM domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019828   Gene: ENSGGOG00000027381   Transcript: ENSGGOT00000026037
Sequence length 72
Comment pep:novel chromosome:gorGor3.1:14:87560673:87561909:1 gene:ENSGGOG00000027381 transcript:ENSGGOT00000026037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAM
FGPKGAESHTFK
Download sequence
Identical sequences ENSGGOP00000019828 ENSGGOP00000019828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]