SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019836 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019836
Domain Number 1 Region: 5-64
Classification Level Classification E-value
Superfamily Cystatin/monellin 0.0000000115
Family Cathelicidin motif 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019836   Gene: ENSGGOG00000024468   Transcript: ENSGGOT00000029866
Sequence length 115
Comment pep:novel chromosome:gorGor3.1:16:35345221:35345588:-1 gene:ENSGGOG00000024468 transcript:ENSGGOT00000029866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HSHLQWAFQETSVDRAVETPFPAGTFVRLEFKLLKTRCRKKNWKKPECKVQPKGSKRKCL
ACVKLGSEDKVGLDGHCPIETQALRDPEEHQRPREGPHSYCFPAQFTFSKAWPPA
Download sequence
Identical sequences ENSGGOP00000019836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]