SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019854 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019854
Domain Number 1 Region: 80-143
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000405
Family C-type lectin domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019854   Gene: ENSGGOG00000027557   Transcript: ENSGGOT00000024756
Sequence length 158
Comment pep:known_by_projection chromosome:gorGor3.1:12:10445565:10447942:-1 gene:ENSGGOG00000027557 transcript:ENSGGOT00000024756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKQRGTYSEVSLAQDPKRQQRKLKGNKSSISGTEQEIFQVELNLQNASSDHQGNDKTYH
CKGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPCIGVLEQNNFSLNRRMQKACDCGHC
PEESITYSYSCYYIGKEKRTWEERVCWPVLRRTLICFL
Download sequence
Identical sequences G3RVM4
ENSGGOP00000019854 ENSGGOP00000019854 XP_004052755.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]