SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019880 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019880
Domain Number 1 Region: 4-41
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000495
Family Laminin G-like module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019880   Gene: ENSGGOG00000012349   Transcript: ENSGGOT00000026111
Sequence length 41
Comment pep:novel chromosome:gorGor3.1:unplaced:20741847:20741969:-1 gene:ENSGGOG00000012349 transcript:ENSGGOT00000026111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLTDIDLQLQFSTSQPEALLLLAAGPADHLLLQLYPGHLQ
Download sequence
Identical sequences ENSGGOP00000019880 ENSGGOP00000019880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]