SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019896 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019896
Domain Number 1 Region: 123-158
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000000106
Family CCCH zinc finger 0.00017
Further Details:      
 
Domain Number 2 Region: 86-121
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000017
Family CCCH zinc finger 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019896   Gene: ENSGGOG00000001402   Transcript: ENSGGOT00000028258
Sequence length 244
Comment pep:known_by_projection chromosome:gorGor3.1:2a:43873074:43874466:-1 gene:ENSGGOG00000001402 transcript:ENSGGOT00000028258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDKKAVGTPGRGFLRRHSATAPSPGSCSPKFPGAANGSSCGSAVAGGPTSRHSQFRDRSF
SENGDRSQHLLHLQQQQKGGGGSQINSTRYKTELCRPFEESGTCKYGEKCQFAHGFHELR
SLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNADERRAVGAGDLWASRPKLHHSLSFGL
PGATISPRAASRLLDSPTSRTPPSDRDSYLSGSLSSGSLSGSESPSLDPGRRLPIFSRLS
ISDD
Download sequence
Identical sequences ENSGGOP00000019896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]