SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019902 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019902
Domain Number 1 Region: 724-869
Classification Level Classification E-value
Superfamily C-type lectin-like 7.7e-29
Family C-type lectin domain 0.0023
Further Details:      
 
Domain Number 2 Region: 303-446
Classification Level Classification E-value
Superfamily C-type lectin-like 6.09e-28
Family C-type lectin domain 0.0042
Further Details:      
 
Domain Number 3 Region: 888-1017
Classification Level Classification E-value
Superfamily C-type lectin-like 2.97e-27
Family C-type lectin domain 0.0007
Further Details:      
 
Domain Number 4 Region: 461-577
Classification Level Classification E-value
Superfamily C-type lectin-like 5.07e-26
Family C-type lectin domain 0.0008
Further Details:      
 
Domain Number 5 Region: 1-148
Classification Level Classification E-value
Superfamily C-type lectin-like 2.7e-20
Family C-type lectin domain 0.0024
Further Details:      
 
Domain Number 6 Region: 593-713
Classification Level Classification E-value
Superfamily C-type lectin-like 9.8e-19
Family C-type lectin domain 0.0055
Further Details:      
 
Domain Number 7 Region: 172-286
Classification Level Classification E-value
Superfamily C-type lectin-like 1.96e-16
Family C-type lectin domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019902   Gene: ENSGGOG00000008295   Transcript: ENSGGOT00000032846
Sequence length 1077
Comment pep:known_by_projection chromosome:gorGor3.1:2b:47390963:47464550:-1 gene:ENSGGOG00000008295 transcript:ENSGGOT00000032846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WDKYNSSCHCVIVFHAERIVRKRNWEEAERFCQALGAHLSSFSHVDEIKEFLHFLTDQFS
GQHWLWIGLNKRSPDLQGSWQWSDRTPVSTIIMPNEFQQDYDIRDCAAVKVFHRPWRRGW
HFYDDREFIYLRPFACDTKLEWVCQIPKGRTPKTPDWYNPERAGIHGPPLIIEGSEYWFV
ADLHLNYEEAVLYCASNHSFLATITSFVGLKAIKNKIANISGDGQKWWITISEWPIDDHF
TYSRYPWHRFPVTFGEECLYMSAKTWLIDLGKPTDCSTKLPFICEKYNVSSLEKYSPDSA
AKVQCSEQWIPFQNKCFLKIKPVSLTFSQASDTCHSYGGTLPSVSSQIEQDFITSLLPDM
EATLWIGLRWTAYERINKWTDNRELTYSNFHPLLVSRRLRIPENFFEEESRYHCALILNL
QKSPFTGTWNFTSCSERHFVSLCQKYSEVKSRQTLQNASETVKYLNNLYKIIPKTLTWHS
AKRECLKSNMQLVSITDPYQQAFLSVQALLHNSSLWIGLFSQDDELNFGWSDGKHLHFSR
WAETNGQLEDCVVLDTDGFWKTVDCNDNQPGAICYYSGNETEKEVKPVDSVKCPSPVLNT
PWIPFQNCCYNFIITKNRHMATTQDEVHTKCQKLNPKSHILSIRDEKENNFVLEQLLYFN
YMASWVMLGITYGNNSLMWFDKTPLSYTHWRAGRPTIKNEKFLAGLSTDGFWDIQTFKVI
EETLYFHQHSILACKIEMVDYKEEYNTTLPQFMPYEDGIYSVIQKKVTWYEALNMCSQSG
GHLASVHNKNGQLFLEDIVKRDGFPLWVGLSSHDGSESSFEWSDGSTFDYIPWKGQTSPG
NCVLLDPKGTWKHEKCNSVKDGAICYKPTKSKKLSRLTYSSRCPAAKENGSRWIQYKGHC
YKSDQALHSFSEAKKLCSKHADHSATIVSIKDEDENKFVSRLMRENNNITMRVWLGLSQR
SVDQSWSWLDGSEVTFVKWENKSKSGVGKCSMLIASNETWKKVECEHGFGRVVCKVPLGP
DYTAIAIIVATLSILVLMGGLIWFLFQRHRLHLAGFSSVRYAQGVNEDEIMLPSFHD
Download sequence
Identical sequences ENSGGOP00000019902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]