SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019909 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019909
Domain Number 1 Region: 359-646
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.15e-56
Family Protein kinases, catalytic subunit 0.00049
Further Details:      
 
Domain Number 2 Region: 81-144
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000118
Family LIM domain 0.0022
Further Details:      
 
Domain Number 3 Region: 188-289
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000013
Family PDZ domain 0.01
Further Details:      
 
Domain Number 4 Region: 139-172
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000242
Family LIM domain 0.0046
Further Details:      
 
Domain Number 5 Region: 51-80
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000147
Family LIM domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019909   Gene: ENSGGOG00000003078   Transcript: ENSGGOT00000022046
Sequence length 677
Comment pep:known_by_projection chromosome:gorGor3.1:7:71100646:71142386:1 gene:ENSGGOG00000003078 transcript:ENSGGOT00000022046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSILELSTSRQGVPPSVLDWTTQFLWTLDSAQTRAPSRTLGRAAPAPGSELPVCASCGQ
RIYDGQYLQALNADWHADCFRCCDCSASLSHQYYEKDGQLFCKKDYWARYGESCHGCSEQ
ITKGLVMVAGELKYHPECFICLTCGTFIGDGDTYTLVEHSKLYCGHCYYQTVVTPVIEQI
LPDSPGSHLPHTVTLVSIPASSHGKRGLSVSIDPPHGPPGCGTEHSHTVRVQGVDPGCMS
PDVKNSIHVGDRILEINGTPIRNVPLDEIDLLIQETSRLLQLTLEHDPHDTLGHGLGPET
SPLSSPAYTPSGEAGSSARQKPVLRSCSIDRSPGAGSLGSPASQRKDLGRSESLRVVCRP
HRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVSERNA
LFPPEGLPGAHPCPINTATIPATGAPTGPTLAILSPSQDSQYPWSQRVSFAKDIASGMAY
LHSMNIIHRDLNSHNCLVRENKNVVVADFGLARLMVDEKTQPEGLRSLKKPDRKKRYTVV
GNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFGLNVRGFLDRY
CPPNCPPSFFPITVRCCDLDPEKRPSFVKLERWLETLRMHLAGHLPLGPQLEQLDRGFWE
TYRRGESGLPAHPEVPD
Download sequence
Identical sequences ENSGGOP00000003026 ENSGGOP00000019909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]