SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019947 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000019947
Domain Number - Region: 178-259
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 0.0379
Family Glycerol-3-phosphate (1)-acyltransferase 0.028
Further Details:      
 
Domain Number - Region: 303-327
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0641
Family B-box zinc-binding domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019947   Gene: ENSGGOG00000016036   Transcript: ENSGGOT00000029445
Sequence length 457
Comment pep:known_by_projection chromosome:gorGor3.1:8:41726114:41748115:1 gene:ENSGGOG00000016036 transcript:ENSGGOT00000029445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLLLPFDSLIVNLLGISLTVLFTLLLVFIIVPAIFGVSFGIRKLYMKTLLKIFAWATLR
MERGAKEKNHQLYKPYTNGIIAKDPTSLEEEIKEIRRSGSSKALDNTPEFELSDIFYFCR
KGMETIMDDEVTKRFSAEELESWNLLSRTNYNFQYISLRLTVLWGLGVLIRYCFLLPLRI
ALAFTGISLLVVGTTVVGYLPNGRFKEFMSKHVHLMCYRICVRALTAIITYHDRENRPRN
GGICVANHTSPIDVIILASDGYYAMVGQVHGGLMGVIQRAMVKACPHVWFERSEVKDRHL
VAKSHCTHHNKQNTNFYCYLKPQRTCINNTSVMMFKKGSFEIGATVYPVAIKYDPQFGDA
FWNSSKYGMVTYLLRMMTSWAIVCSVWYLPPMTREADEDAVQFANRVKSAIARQGGLVDL
LWDGGLKREKVKDTFKEEQQKLYSKMIVGNHKDRSRS
Download sequence
Identical sequences ENSGGOP00000019947 ENSGGOP00000019947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]