SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019952 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019952
Domain Number 1 Region: 5-353
Classification Level Classification E-value
Superfamily Sema domain 9.68e-55
Family Sema domain 0.0099
Further Details:      
 
Domain Number 2 Region: 1217-1342,1508-1664
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.57e-33
Family p120GAP domain-like 0.023
Further Details:      
 
Domain Number 3 Region: 785-875
Classification Level Classification E-value
Superfamily E set domains 8.17e-16
Family E-set domains of sugar-utilizing enzymes 0.059
Further Details:      
 
Domain Number 4 Region: 694-785
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000061
Family Other IPT/TIG domains 0.019
Further Details:      
 
Domain Number 5 Region: 872-953
Classification Level Classification E-value
Superfamily E set domains 0.00000000000402
Family E-set domains of sugar-utilizing enzymes 0.074
Further Details:      
 
Domain Number 6 Region: 356-408
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000889
Family Plexin repeat 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000019952
Domain Number - Region: 1014-1066
Classification Level Classification E-value
Superfamily E set domains 0.00252
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.089
Further Details:      
 
Domain Number - Region: 516-555
Classification Level Classification E-value
Superfamily Plexin repeat 0.00419
Family Plexin repeat 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019952   Gene: ENSGGOG00000000736   Transcript: ENSGGOT00000034533
Sequence length 1732
Comment pep:known_by_projection chromosome:gorGor3.1:3:129494470:129545335:-1 gene:ENSGGOG00000000736 transcript:ENSGGOT00000034533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMLNVAANHPNASTVGLVLPRLLVGATYTGYGSSFFPRNRSLEDHRFENTPEIAIRSLDT
RGDLAKLFTFDLNPSDDNILKIKQGAKEQHKLGFVSAFLHPSDPPPGAQSYAYLALNSEA
RAGDKESQARSLLARICLPHGAGGDAKKLTESYIQLGLQDLYSRLVSVFPARERLFAVFE
RPQGSPAARAAPAALCAFRFADVRAAIRAARTACFVEPAPDVVAVLDSVVQGTGPACERK
LNIQLQPEQLDCGAAHLQHPLSILQPLKATPVFRAPGLTSVAVASVNNYTAVFLGTVNGR
LLKINLNENMQVVSRRVVTVAYGEPVHHVMQFDPADSGYLYLMTSHQMARVKVAACNVHS
TCGDCVGAADAYCGWCALETRCTLQQDCANSSQQHFWTSASEGPSRCPAMTVLPAEIDVR
QEYPGMILQISGSLPSLSGMEMACDYGNNIRTVARVPGPAFGHQIAYCNLLPRDQFPPFP
RNQDHVTVEMSVRVNGRNIVKANFTIYDCSRTAEVYPHTACTSCLSAQWPCFWCSQQHSC
VSNQSRCEASPNPTSPQDCPRTLLSPLAPVPTGGSQNILVPLANTAFFQGAALECSFGLE
EFFEAVWVNESVVRCDQVVLHTTRKSQVFPLSLQLKGRPARFLDSPEPMTVMVYNCAMGS
PDCSQCLGREDLGHLCVWSDGCRLRGPLQPMAGTCPAPEIRAIEPLSGPLDGGTLLTIRG
RNLGRRLSDVAHGVWIGGVACEPLPDRYTVSEEIVCVTGPAPGPLSGVVTVNASKEGKSR
DRFSYVLPLVHSLEPTMGPKAGGTRITIHGNHLHVGSELQVLVNDTDPCTELMRTDTSIA
CTMPEGALPAPVPVCVRFERRGCVHSNLTFWYMQNPVITAISPRRSPVSGGRTITVAGER
FHMVQNVSMAVHHIGREPTLCKVLNSTLITCPSPGALSNASAPVDFFINGRAYADEVAVA
EELLDPEEAQRGSRFRLDYLPNPQFSTAKREKWIKHHPGEPLTLVIHKEQDSLGLQSHEY
RVKIGQVSCDIQIVSDRIIHCSVNESLGAAEGQLPITIQVGNFNQTIATLQLGGSETAII
VSIVICSVLLLLSVVALFVFCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDM
TDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEERYVLPSQTLNSQGSSQAQETHPLL
GEWKIPESCRPNMEEGISLFSSLLNNKHFLIVFVHALEQQKDFAVRDRCSLASLLTIALH
GKLEYYTSIMKELLVDLIDASAAKNPKLMLRRTESVVEKMLTNWMSICMYSCLRETVGEP
FFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNLNVSFQGCGMDSLSVR
AMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDLEWFASSTQSYILRDLDDTSVVEDGR
KKLNTLAHYKIPEGASLAMSLIDKKDNTLGRVKDLDTEKYFHLVLPTDELAEPKKSHRQS
HRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPPLAVKYFFDFLEEQAEKRGI
SDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHIDACLSVIAQAFIDACSISDLQL
GKDSPTNKLLYAKEIPEYRKIVQRYYKQIQDMTPLSEQEMNAHLAEESRKYQNEFNTNVA
MAEIYKYAKRYRPQIMAALEANPTARRTQLQHKFEQVVALMEDNIYECYSEA
Download sequence
Identical sequences ENSGGOP00000019952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]