SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019979 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019979
Domain Number 1 Region: 1596-1806
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.31e-28
Family Extended AAA-ATPase domain 0.026
Further Details:      
 
Domain Number 2 Region: 2552-2674,2705-2822
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.82e-18
Family Extended AAA-ATPase domain 0.084
Further Details:      
 
Domain Number 3 Region: 2220-2492
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.76e-17
Family Extended AAA-ATPase domain 0.079
Further Details:      
 
Domain Number 4 Region: 1826-2040
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000016
Family ABC transporter ATPase domain-like 0.064
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000019979
Domain Number - Region: 3003-3095
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0534
Family FCH domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019979   Gene: ENSGGOG00000004210   Transcript: ENSGGOT00000028088
Sequence length 4257
Comment pep:known_by_projection chromosome:gorGor3.1:12:123683514:123839845:1 gene:ENSGGOG00000004210 transcript:ENSGGOT00000028088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEIKLEMPTISVEGEVSDLAADPETVDILEQCVINWLNQISTAVEGQLKKTPQGKGPLAE
IEFWRERNATLSALHEQTKLPIVRKVLDVIKESDSMLVANLQPVFTELFKFHTEASDNVR
FLSTVERYFKNITHGSGFHVVLDTIPAMMSALRMVWVISRHYNKDERMIPLMERIAWEIA
ERVCRVVNLRTLFKENRASAQSKTLEARNTLRLWKKAYFDTRAKIEASGREARWEFDRKR
LFERTDYMATICQDLSDVLQVLEEFYNIFGPELKAVTGDPKRIDDVLCRVDGLVTPMENL
TFDPFSIKSSQFWKYVMDEFKIEVLITSNTCLLIIKNKINAEVHKNFEPFFGFIKWRNSI
RSNLEHCISRAMRVSPVSSGSRQLCGQDVKQKYLEVGRTMKEYEDRKYEQWMEVTEQVLP
ALMKKSLLTKSSIATEEPSTLERGAVFAINFSPALREIINETKYLEQLGFTVPELARNVA
LQEDKFLRYTDGIQRMLDHYHMLIGTLNDAESVLLNDHSQELLRVFRSGYKRLNWNSLEG
IGDYITGCKQAIGKFESLVHQIHKNADDISSRLTLIEAINLFKYPAAKSEEELPGVKEFF
EHIERERARDVDHMVRWYLAIGPLLTKVEGLVVHTNTGKAPKLASYYKYWEKKIYEVLTK
LILKNLQSFNSLILGNVPLFHTETILTAPEIILHPNTNEIDKMCFHCVRNCVEITKHFVR
WMNGSCIECPPQKGEEEEVVIINFYNDISLNPQIIEQAVMIPQNVHRILINLMKYLQKWK
RYRPLWKLDKAIVMEKFAARKPPCVAYDEKLQFYSKIAYEVMRHPLIKDEHCIRLQLGHL
ANTVQENAKSWVISLGKLLNESAKEELYNLHEEMEHLAKNLRKIPNTLEDLKFVLATIAE
IRSKSLVMELRYRDVQERYRTMAMYNLFPPDAEKELVDKIESMWSNLFNDSVNVEHALGD
IKRTFTELTRGEIMNYRVQIEEFAKRFYNEGPGSVGDDLDKGVELLGVYERELARHEKSR
QELANAEKLFDLPITMYPELLKVQKEMSGLRMIYELYEGLKVAKEEWSQTLWINLNVQNL
QEGIEGFLRALRKLPRPVRGLSVAYYLEAKMKAFKDSIPLLLDLKNEALRDRHWKELMEK
TSVFFEMTETFTLENMFAMELHKHTDVLNEIVTAAIKEVAIEKAVKEILDTWENMKFTVV
KYCKGTQERGYILGSVDEIIQSLDDNTFNLQSISGSRFVGPFLQTVHKWEKTLSLIGEVI
EIWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDNIDKVFKRIMGETSKDPVIKRCCEAP
NRLSDLQNVSEGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDPLCVQEHMIK
MYDNIASLRFNDGDSGEKLVSAMISAEGEVMEFRKIVRAEGRVEDWMTAVLNEMRRTNRL
ITKEAIFRYCEDRSRVDWMLLYQGMVVLAASQVWWTWEVEDVFHKVQKGEKQAMKNYGRK
MHRQIDELVTRISMPLSKNDRKKYNTVLIIDVHARDIVDSFIRGSILEAREFEWESQLRF
YWDREPDELNIRQCTGTFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPA
GTGKTETTKDLAKALGLLCVVTNCGEGMDYKAVGKIFSGLAQCGAWGCFDEFNRIDASVL
SVISSQIQTIRNALIHQLTTFQFEGQEISLDSRMGIFITMNPGYAGRTELPESVKALFRP
VVVIVPDLQQICEIMLFSEGFLEAKTLAKKMTVLYKLAREQLSKQYHYDFGLRALKSVLV
MAGELKRGSSDLREDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPDFS
DAVEQVLEENGYAVLPIQVDKVVQMFETMLTRHTTMVVGPTRGGKSVIINTLCQAQTKLG
LMTKLYILNPKAVSVIELYGILDPTTRDWTDGVLSNIFREINKPTDKKERKYILFDGDVD
ALWVENMNSVMDDNRLLTLANGERIRLQAHCALLFEVGDLQYASPATVSRCGMVYVDPKN
LKYRPYWKKWVNQIPNKVEQYHLNSLFEKYVPYLMDVIVEGIVDGRQAEKLKTIVPQTDL
NMVTQLAKMLDALLEGEIEDLDLLECYFLEALYCSLGASLLEDGRMKFDEYIKRLASLST
VDTEGVWANPGELPGQLPTLYDFHFDNKRNQWVPWSKLVPEYIHAPERKFINILVHTVDT
TRTTWILEQMVKIKQPVIFVGESGTSKTATTQNFVKNLSEETNIVLMVNFSSRTTSMDIQ
RNLEANVEKRTKDTYGPPMGKRLLVFMDDMNMPRKIKVDEYGTQQPIALLKLLLEKGYLY
DRGKELNCKSIRDLGFIAAMGKAGGGRNEVDPRFISLFSVFNVPFPSEESLHLIYSSILK
GHTSAFAFKTVRISSKIHIMTLMLTLNSCIPTSRDDVRYLFYVIYRQRSFFLSYICRFQT
VAQMVRVWRNECLRVFHDRLISETDKQLVQQHIGSLVAEHFNDDLEVVMRDPILFGDFQM
ALHEGEPRIYEDIQDYEAAKALFQEILEEYSESNTKMNLVLFDDALEHLTRVHRIIRMDR
GHALLVGVGGSGKQSLSRLAAFTAGCEVFEILLSRGYSENDFREDLKSLYLKLGIENKAM
IFLFTDAHVAEEGFLELINNMLTSGIVPALFPEEEKESILSQIGQEALKQGMGPAKESVW
QYFVNKSANNLHIVLGMSPVGDTLRTWCRNFPEVPNGQGKDWHGSLLWPEKPPIIFIPSS
SGYNPMIPAENIENVMKHVVLVHQSVGHYSKQFLQKLRRSNYVTPKNYLDFINTYSKLLD
EKTQYNIAQCKRLDGGLDKLKEATIQLDELSQKLAEQKIVLAEKSAACEALLEEIAVNTA
VAEEKKKLAEEKAMEIEEQNKVIAMEKAEAETTLAEVMPILEAAKLELQKLDKSDVTEIR
SFAKPPKQVQTVCECILIMKGYKELNWKTAKGMMSDPNFLRSLMEIDFDSITQSQVKNIK
GLLKTLNTTTEEMEAVSKAGLGMLKFVEAVMGYCDVFREIKPKREKVARLERNFYLTKRE
LERIQNELAAIQKELETLGAKYEAAILEKQKLQEEAEIMERRLIAADKLISGLGSENIRW
LNDLDELMHRRVKLLGDCLLCAAFLSYEGAFTWEFRDEMVNRIWQNDILEREIPLSQPFR
LESLLTDDVEISRWGSQGLPPDELSVQNGILTTRASRFPLCIDPQQQALNWIKRKEEKNN
LRVASFNDPDFLKQLEMSIKYGTPFLFRDVDEYIDPVIDNVLEKNIKVSQGRQFIILGDK
EVDYDSNFRLYLNTKLANPRYSPSVFGKAMVINYTVTLKGLEDQLLSVLVAYERWELEEQ
REHLIQETSENKNLLKDLEDSLLRELATSTGNMLDNVDLVHTLEETKSKATEVSEKLKLA
EKTALDIDRLRDGYRPAARRGAILFFVLSEMALVNSMYQYSLIAFLEVFRLSLKKSLPDS
ILMKRLRNIMDTLTFNIYNYGCTGLFERHKLLFSFNMTIKIEQAEGRVPQEELDFFLKGN
ISLEKSKRKKPCAWLSDQGWEDIILLSEMFSDNFGQLPDDVENNQTVWREWYDLDSLEQF
PLPLGYDNNITPFQKLLILRCFRVDRVYRAVTDYVTVTMGEKYVQPPMISFEAVFEQSTP
HSPIVFILSPGSDPATDLMKLAERSGFGGNRLKFLAMGQGQEKVALQLLETAVARGQWLM
LQNCHLLVKWLKDLEKSLERITKPHPDFRLWLTTDPTKGFPIGILQKSLKVVTEPPNGLK
LNMRATYFKISHEMLDQCPHPAFKPLVYVLAFFHAVVQERRKFGKIGWNVYYDFNESDFQ
VCMEILNTYLTKAFQQRDPRIPWGSLKYLIGEVMYGGRAIDSFDRRILTIYMDEYLGDFI
FDTFQPFHFFRNKEVDYKIPVGDEKEKFVEAIEALPLANTPEVFGLHPNAEIGYYTQAAR
DMWAHLLELQPQTGESSSGISRDDYIGQVAKEIENKMPKVFDLDQVRKRLGTGLSPTSVV
LLQELERFNKLVVRMTKSLAELQRALAGEVGMSNELDDVARSLFIGHIPNIWRRLAPDTL
KSLGNWMVYFLRRFSQYMLWVTESEPSVMWLSGLHIPESYLTALVQATCRKNGWPLDRST
LFTQVTKFQDADEVNERAGQGCFVSGLYLEGADWDIEKGCLIKSKPKVLVVDLPILKIIP
IEAHRLKLQNTFRTPVYTTSMRRNAMGVGLVFEADLFTTRHISHWVLQGVCLTLNSD
Download sequence
Identical sequences ENSGGOP00000004156 ENSGGOP00000019979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]