SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020009 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020009
Domain Number 1 Region: 294-454
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.35e-54
Family SPRY domain 0.0000316
Further Details:      
 
Domain Number 2 Region: 20-89
Classification Level Classification E-value
Superfamily RING/U-box 8.48e-17
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 112-165
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000148
Family B-box zinc-binding domain 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000020009
Domain Number - Region: 151-240
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0105
Family BAR domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020009   Gene: ENSGGOG00000023102   Transcript: ENSGGOT00000033913
Sequence length 463
Comment pep:novel chromosome:gorGor3.1:4:175473065:175474490:1 gene:ENSGGOG00000023102 transcript:ENSGGOT00000033913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSSFSVQTFIHSLMAEAAALAGLQEEAKCSICLGYLSDPVPIECEHNFCHSCIQQSWLDL
QELFPCPVCSHQCPEGNFRSNTQLGRMIDIAKLLQRARGNDVRQDKMPLWEKHNQPLSVF
CEEDLVVLCPLCTQPHDHQGHHVSPIEEAASHHRERLHSYLEPLRKLRATQDRKLLELRE
KTESQRQELSSQLKHLMKFVEHEKQAAFCRLAEEKKDIQKKLGANIRAFSEHISTLKGLL
TQVAEMSVMADVKLLMDVRTVLHRCKLQTPAVRSVQLQKEGNRLPLQYSALQKIIQKFRE
VTLDPESAHPHLRVSEDKKCVTFVKESQRVHWNPKRLLSHPVVLGSEGFECGRHYWEVQV
DDKPMWTVGVCKESLPRKGKWPLSGQSMCWAIQLQNGDLPLKEKPRGIGIYLDYKLGEIS
FYNLNDRSHIHSFTDTFSEVLKPYFCMGHDSKPLRIFIMTDYD
Download sequence
Identical sequences ENSGGOP00000020009 ENSGGOP00000020009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]