SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020010 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000020010
Domain Number - Region: 3-45
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.000653
Family beta-glycanases 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020010   Gene: ENSGGOG00000027877   Transcript: ENSGGOT00000032685
Sequence length 46
Comment pep:novel chromosome:gorGor3.1:17:26827281:26827418:1 gene:ENSGGOG00000027877 transcript:ENSGGOT00000032685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNPPLMFTEEYQKSLLEQYHLGLDQKRRKYVVGELIWNFADFMTNQ
Download sequence
Identical sequences ENSGGOP00000020010 ENSGGOP00000028015 ENSGGOP00000020010 ENSGGOP00000028015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]