SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020044 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020044
Domain Number 1 Region: 495-827
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.12e-92
Family PDEase 0.000000961
Further Details:      
 
Domain Number 2 Region: 52-250
Classification Level Classification E-value
Superfamily GAF domain-like 2.84e-36
Family GAF domain 0.00026
Further Details:      
 
Domain Number 3 Region: 236-280,307-456
Classification Level Classification E-value
Superfamily GAF domain-like 4.32e-31
Family GAF domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020044   Gene: ENSGGOG00000005730   Transcript: ENSGGOT00000030378
Sequence length 855
Comment pep:known_by_projection chromosome:gorGor3.1:4:612736:658270:1 gene:ENSGGOG00000005730 transcript:ENSGGOT00000030378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSEEQARSFLDQNPDFARQYFGKKLSPENVAAACEDGCPLDCDSLRELCQVEESTALL
ELVQDMQESINMERVVFKVLRRLCTLLQADHCSLFMYRQRNGVAELATRLFSVQPDSVLE
DCLVPPDSEIVFPLDIGVVGHVAQTKKMVNVKDVAEQCPHFSSFADELTDYKTKNMLATP
IMNGKDVVAVIMAVNKLNGPFFTSEDEDVFLKYVNFATLYLKIYHLSYLHNCETRRGQVL
LWSANKVFEELTDIERQFHKAFYTVRAYLNCERYSVGLLDMTKEKEFFDVWPVLMGESQP
YSGPRTPDGREIVFYKVIDYILHGKEEIKVIPAPPADHWALASGLPSYVAESGFICNIMN
ASADEMFKFQEGALDDSGWLIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDEQDEVLME
SLTQFLGWSVMNTDTYDKMNKLENRKDIAQDMVLYHVKCDRDEIQLILPTRVRLGKEPAD
CDEDELGEILKEELPGPTTFDIYEFHFSDLECTELDLVKCGIQMYYELGVVRKFQIPQEE
VSIKQIKQASRKKQRINEWWANGTNVAQTMFTLLMTGKLKSYYTDLEAFAMVTAGLCHDI
DHRGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKFLLSEETLNIYQNLNRRQHEHVIHL
MDIAIIATDLALYFKKRAMFQKIVDESKNYEDKKSWVEYLSLETTRKEIVMAMMMTACDL
SAITKPWEVQSKVALLVAAEFWEQGDLERTVLDQQPIPMMDRNKAAELPKLQVGFIDFVC
TFVYKEFSRFHEEILPMFDRLQNNRKEWKALADEYEAKVKALEEKKEEERVAAKKVGTEI
CNGGPAPKSSTCCIL
Download sequence
Identical sequences ENSGGOP00000020044 ENSGGOP00000005614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]