SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020057 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020057
Domain Number 1 Region: 213-286
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.7e-25
Family SPRY domain 0.00072
Further Details:      
 
Domain Number 2 Region: 16-76
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.53e-17
Family B-box zinc-binding domain 0.00013
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000020057
Domain Number - Region: 59-148
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.017
Family Apolipoprotein A-I 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020057   Gene: ENSGGOG00000016403   Transcript: ENSGGOT00000030641
Sequence length 421
Comment pep:known_by_projection chromosome:gorGor3.1:6:31313680:31333539:1 gene:ENSGGOG00000016403 transcript:ENSGGOT00000030641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEIAKQLQAVKRKIRDESLCPQHHEALSLFCYEDQEAVCLICAISHTHRAHTVVPLDDA
TQEYKEKLQKCLEPLEQKLQEITRCKSSEEKKPGELKRLVESRRQQILREFEELHRRLDE
EQQVLLSRLEEEEQDILQRLRENAAHLGDKRRDLAHLAAEVEGKCLQSGFEMLKDVKSTL
EKCEKVKTMEVTSVSIELEKNFSNFPRQYFALRKILKQLIADVTLDPETAHPNLVLSEDR
KSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWEVEAAHCVLAQDPENQALARF
YCYTERTIAKRLVLRRDPSVKRTLCRGCSSLLVPGLTCRKRLTGFTLGCRGQRWTVQTCL
TCQRSQRFLNDPGHLLWGDRPEAQLGSQADSKPLQPLPNTAHSISDRLPEEKMQTRGSSN
Q
Download sequence
Identical sequences ENSGGOP00000020057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]