SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020067 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000020067
Domain Number - Region: 5-37
Classification Level Classification E-value
Superfamily Anaphylotoxins (complement system) 0.017
Family Anaphylotoxins (complement system) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020067   Gene: ENSGGOG00000025000   Transcript: ENSGGOT00000032061
Sequence length 110
Comment pep:novel chromosome:gorGor3.1:8:51411433:51412062:1 gene:ENSGGOG00000025000 transcript:ENSGGOT00000032061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGKSECERDSQLVSGGEDCFLINQFCCEVRKDEQVEKTSYLDKFFSRKEDPEMLETEPVE
DEKLGERGNEEGFLNNSGEFLSYKQLESIGIPQFHSPVGSPLKSTQATGT
Download sequence
Identical sequences ENSGGOP00000020067 ENSGGOP00000021951 ENSGGOP00000020067 ENSGGOP00000021951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]