SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020118 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020118
Domain Number 1 Region: 76-153
Classification Level Classification E-value
Superfamily HMG-box 2.75e-18
Family HMG-box 0.0000579
Further Details:      
 
Domain Number 2 Region: 3-69
Classification Level Classification E-value
Superfamily HMG-box 0.00000000000000419
Family HMG-box 0.0000637
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020118   Gene: ENSGGOG00000023265   Transcript: ENSGGOT00000029735
Sequence length 164
Comment pep:novel chromosome:gorGor3.1:8:106525932:106526435:-1 gene:ENSGGOG00000023265 transcript:ENSGGOT00000029735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGKGGPKKPRGKMSLHAFFAQTCQEELKKKHPDVSVNFSEFSKKCSDRRKTMSAKEKRKF
ADMSKVNKTVKKEIETYSPLKGKIKKKFKDSNVLKRPPSAFFLFCSEYCSKIKGVHPGLS
IGETELWNDTAADDMHSYEKKAAKLKEKYEKDIAVHGAKGKPDA
Download sequence
Identical sequences ENSGGOP00000020118 ENSGGOP00000020118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]