SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020125 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020125
Domain Number 1 Region: 155-259,383-479,895-1127
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 6.41e-66
Family Calcium ATPase, transmembrane domain M 0.01
Further Details:      
 
Domain Number 2 Region: 481-496,643-751,821-899
Classification Level Classification E-value
Superfamily HAD-like 5.24e-29
Family Meta-cation ATPase, catalytic domain P 0.0037
Further Details:      
 
Domain Number 3 Region: 491-699
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 2.83e-22
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0084
Further Details:      
 
Domain Number 4 Region: 270-385
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 2.88e-18
Family Calcium ATPase, transduction domain A 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020125   Gene: ENSGGOG00000007060   Transcript: ENSGGOT00000024587
Sequence length 1198
Comment pep:known_by_projection chromosome:gorGor3.1:3:195075461:195192929:-1 gene:ENSGGOG00000007060 transcript:ENSGGOT00000024587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKNGSWTQDKPLSFSRHNQCKEIFGYRTQGCRKSLCLAGSIFSFGILPLVFYWRPAWHV
WAHCVPCSLQEADTVLLRTTDEFQIYSWKKVIWIYLSALNSAFGLTPDHPLMTDEEYIIN
RAIRKPDLKVRCIKVQKIRYVWNYLEGQFQKIGSLEDWLSSAKIHQKFGSGLTREEQEIR
RLICGPNTIDVEVTPIWKLLIKEVLNPFYIFQLFSVCLWFSEDYKEYAFAIIIMSIISIS
LTVYDLREQSVKLHHLVESHNSITVSVCGRKAGVQELESRVLVPGDLLILTGNKVLMPCD
AVLIEGSCVVDEGMLTGESIPVTKTPLPKMDSSVPWKTQSEADYKRHVLFCGTEVIQAKA
ACSGTVRAVVLQTGFNTAKGDLVRSILYPKPVNFQLYRDIRFLLCLVGTATIGMIYTLCV
YVLSGEPPEEVVRKALDVITIAVPPALPAALTTGIIYAQRRLKKRGIFCISPQRINVCGQ
LNLVCFDKTGTLTRDGLDLWGVVSCDRNGFQEVHSFASGQAVPWGPLCAAMASCHSLILL
DGTIQGDPLDLKMFEATTWEMAFSGDDFHIKGVPAHAMVVKPCRTASQVPVEGIAILHQF
PFSSALQRMTVIVQEMGGDRLAFMKGAPERVASFCQPETVPTSFVSELQIYTTQGFRVIA
LAYKKLENDHHATTLTRETVESDLIFLGLLILENRLKEETKPVLEELISARIRTVMITVG
DNLQTAITVARKSGMVSESQKVILIEANETTGSSSASISWTLVEEKKHITYGNQDNYINI
RDEVSDKGREGSYHFALTGKSFDVISQHFSSLLPKILINGTIFARMSPGQKSSLVEEFQK
LDYFVGMCGDGANDCGALKMAHVGISLSEQEASVASPFTSKTPNIECVPHLIKEGRAALV
TSFCMFKYMALYSMIQYVGVLLLYWETNSLSNYQFLFQDLAITTLIGVTMNLNGAYPKLV
PFRPAGRLISPPLLLSVIFNILLSLAMHVAGFILVQRQPWYSVEIHSACTVQNESISELT
VSPTAPEKMESNSAFTSFENTTIWFLGTINCIIVALVFSKGKPFRQPTYTNYIFVLVLII
QLGVCLFILFADIPELYRRLDLLCTPVLWRASIVIMLSLNFIVSLVAEEAVIENRALWMM
IKRCFGYQSKSQYRIWQRDLANDPSWPPLNQTSHSDMPECGRGVSYSNPVFESNEEQL
Download sequence
Identical sequences ENSGGOP00000020125 ENSGGOP00000020125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]