SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020152 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020152
Domain Number 1 Region: 21-107
Classification Level Classification E-value
Superfamily Cystatin/monellin 0.0000000000051
Family Cystatins 0.084
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000020152
Domain Number - Region: 149-220
Classification Level Classification E-value
Superfamily Cystatin/monellin 0.000109
Family Cystatins 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020152   Gene: ENSGGOG00000024591   Transcript: ENSGGOT00000029494
Sequence length 520
Comment pep:known_by_projection chromosome:gorGor3.1:3:188118164:188130369:1 gene:ENSGGOG00000024591 transcript:ENSGGOT00000029494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALIAALLLITLEYSCAVSPTDCSAVEPEAEKTLDLINKRRRDGYLFQLLLIADAHLDR
VENTTVYYLVLDVQESDCSVLSRKYWNDCEPPDSRRPSEIVIGQCKVIATRHSHESQDLR
VIDFNCTTSSVSSALANTKDSPVLIDFFEDTERYRKQADKALEKYKEENDDFASFRVDRI
ERVAKVRGGEGTGYFVDFSVRNCSRHHFPRHPNVFGFCRADLFYDVEALDLESPKNLVIN
CEVFDPQEHENIDGAPPHLGHPFHWGGHERSSATKPPFKPHGSRDHHHPHKPHEHGPPPP
PEERYHSHGPPLPQGPPPLLPMSCSSCQHATFGTNGAQRHSHNNNSSDLHPHKHHSHEQH
PHGHHPHAHHPHEHDTHRQHPHGHHPHGHHPHGHHPHGHHPHCHDFQDYGPCDPPPHNQG
HCCHGHGPPPGHLRKRGPGKGPRPFHCRQIGSVYRLPPLRKGEVLPLPEANFPSFPLPHH
KHPLKPDIQPFPQSVSESCPGKFKSGFPQVSTFFTHTFPK
Download sequence
Identical sequences ENSGGOP00000020152 ENSGGOP00000024266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]