SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020157 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020157
Domain Number 1 Region: 3-92
Classification Level Classification E-value
Superfamily EF-hand 1.96e-20
Family S100 proteins 0.0000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020157   Gene: ENSGGOG00000026672   Transcript: ENSGGOT00000023505
Sequence length 101
Comment pep:known_by_projection chromosome:gorGor3.1:1:132520341:132522251:-1 gene:ENSGGOG00000026672 transcript:ENSGGOT00000023505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMS
VLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ
Download sequence
Identical sequences G1RHG4 G3RWH4 H2Q033 P33764
ENSP00000357701 ENSP00000357702 1kso_A 1kso_B 3nsi_A 3nsi_B 3nso_A 3nso_B ENSP00000357701 ENSPTRP00000002280 1ksoA ENSPTRP00000002280 ENSNLEP00000012664 cath|current|1ksoA00/2-94 cath|current|1ksoB00/2-94 cath|current|3nsiA00/4-99 cath|current|3nsiB00/3-99 cath|current|3nsoA00/2-99 cath|current|3nsoB00/3-99 NP_002951.1.87134 NP_002951.1.92137 XP_003259354.1.23891 XP_003259356.1.23891 XP_003259357.1.23891 XP_003339048.1.37143 XP_003817216.1.60992 XP_004026784.1.27298 ENSNLEP00000012664 ENSGGOP00000020157 9598.ENSPTRP00000002280 9606.ENSP00000357701 ENSGGOP00000020157 gi|4506763|ref|NP_002951.1| ENSP00000357701 ENSP00000357702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]