SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020159 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020159
Domain Number 1 Region: 546-610
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000222
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020159   Gene: ENSGGOG00000003667   Transcript: ENSGGOT00000032594
Sequence length 656
Comment pep:known_by_projection chromosome:gorGor3.1:19:1610548:1648825:-1 gene:ENSGGOG00000003667 transcript:ENSGGOT00000032594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGLEDRPSSGSW
GSGDQSSSSFDPSRTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGG
LTQAGFLSGELALSSPGPLSPSGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVRKVPPG
LPSSVYPPGSGEDYGRDAAAYPSAKTPSSAYPAPFYVADGSLHPSAELWSPPGQAGFGPM
LGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGA
TYGGVSSHTPPVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGS
PQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDEAIHVLRSHAVGTAGDMHTLL
PGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPP
DSYSALSTGERGRGVQQDASASGETDQELAAQGKADELFSKAAKLPSHRQDFDCSTDEVL
SLEEKDLRDRERRMANNARERVRVRDINEAFRELGRMCQMHLKSDKAQTKLLILQQAVQV
ILGLEQQVRERNLNPKAACLKRREEEKASGVVGDPQMVLSAPHPGLSEAHNPAGHM
Download sequence
Identical sequences ENSGGOP00000003612 ENSGGOP00000020159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]