SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020174 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020174
Domain Number 1 Region: 17-283
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.13e-81
Family Amylase, catalytic domain 0.0000000000831
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020174   Gene: ENSGGOG00000023997   Transcript: ENSGGOT00000027357
Sequence length 284
Comment pep:novel chromosome:gorGor3.1:1:106440252:106443445:1 gene:ENSGGOG00000023997 transcript:ENSGGOT00000027357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFFLLLFTIGFCWAQYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPP
NENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGN
AVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGL
LDLALGKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPEG
SKPFIYQEVIDLGGEPIKGSDYFGNGRVTEFKYGAKLGTVIRKW
Download sequence
Identical sequences ENSGGOP00000020174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]