SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020253 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020253
Domain Number 1 Region: 1-90
Classification Level Classification E-value
Superfamily EF-hand 5.44e-19
Family S100 proteins 0.0000263
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020253   Gene: ENSGGOG00000027329   Transcript: ENSGGOT00000026245
Sequence length 93
Comment pep:novel chromosome:gorGor3.1:1:132369022:132370062:-1 gene:ENSGGOG00000027329 transcript:ENSGGOT00000026245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTELEKALNSIIEVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDI
NTDGAVNFQEFLILVIKMGVAAHKKSHEESHKD
Download sequence
Identical sequences G3RWR9
ENSGGOP00000020253 ENSGGOP00000027573 ENSGGOP00000020253 ENSGGOP00000027573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]