SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020264 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020264
Domain Number 1 Region: 320-498,525-556
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.65e-20
Family Clostridium neurotoxins, the second last domain 0.043
Further Details:      
 
Domain Number 2 Region: 138-248
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000123
Family Cadherin 0.0033
Further Details:      
 
Domain Number 3 Region: 31-150
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000571
Family Cadherin 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020264   Gene: ENSGGOG00000011560   Transcript: ENSGGOT00000034189
Sequence length 963
Comment pep:known_by_projection chromosome:gorGor3.1:12:7323201:7352424:1 gene:ENSGGOG00000011560 transcript:ENSGGOT00000034189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLLLLPLLLASLLAPCSCNKANKHKPWIEAEYQGIVMENDNTVLLNPPLFALDKDAPLR
YAGLEALGGCCSVRLHGSGVPFEAVILDKATGEGLIRAKEPVDCEAQKEHTFTIQAYDCG
EGPDGANTKKSHKATVHVRVNDVNEFAPVFVERLYRAAVTEGKLYDRILRVEAIDGDCSP
QYSQICYYEILTPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCGKKRAADDAEVE
IQVKPTCKPSWQGWNKRIEYAPGAGSLALFPGIRLETCDEPLWNIQATIELQTSHVAKGC
DRDNYSERALRKLCGAATGEVDLLPMPGPNANWTAGLSVHYSQDSSLIYWFNGTQAVQVP
LGGPSGLGSGPQDSLSDHFTLSFWMKHGVTPNKGKKEEETIVCNTVQNEDGFSHYSLTVH
GCRIAFLYWPLLESARPVKFLWKLEQVCDDEWHHYALNLEFPTVTLYTDGISFDPALIHD
NGLIHPPRREPALMIGACWTAPEEKNKEKEKGDNSTDTTQGDPLLIHHYFHGYLAGFSVR
SGRLESREVIECLYACREGLDYRDFESLGKGMKVHVNPSQSLLTLEGDDVETFNHALQHV
AYMNTLRFATPGVRPLRLTTAVKCFSEESCVSIPEVEGYVVVLQPDAPQILLSGTAHFAR
PAVDFEGTEGVPLFPDLQITCSISHQVEAKKDESWQGTVTDTRMSDEIVHNLDGCEISLV
GDDLDPERESLLLDTTSLQQRGLELTNTSAYLTIAGVESITVYEEILRQARYRLRHGAAL
YTRKFRLSCSEMNGRYSSNEFIVEVNVLHSMNRVAHPSHVLSSQQFLHRGHQPPPEMAGH
SLASSHRNSMIPSAATLIIVVCVGFLVLMVVLGLVRIHSLHRRVSGAGGPPGASSDPKDP
DLFWDDSALTIIVNPMESYQNRQSCVTGAVGGQQEDEDSSDSEVADSPSSDERRIIETPP
HRY
Download sequence
Identical sequences ENSGGOP00000011282 ENSGGOP00000020264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]