SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020290 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020290
Domain Number 1 Region: 317-567
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.82e-91
Family STAT DNA-binding domain 0.000000496
Further Details:      
 
Domain Number 2 Region: 139-316
Classification Level Classification E-value
Superfamily STAT 7.06e-45
Family STAT 0.00015
Further Details:      
 
Domain Number 3 Region: 568-686
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-40
Family SH2 domain 0.0000253
Further Details:      
 
Domain Number 4 Region: 1-124
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 1.26e-33
Family Transcription factor STAT-4 N-domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020290   Gene: ENSGGOG00000006127   Transcript: ENSGGOT00000028802
Sequence length 847
Comment pep:known_by_projection chromosome:gorGor3.1:12:54431992:54451795:-1 gene:ENSGGOG00000006127 transcript:ENSGGOT00000028802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQWEMLQNLDSPFQDQLHQLYSHSLLPVDIRQYLAVWIEDQNWQEAALGSDDSKATMLF
FHFLDQLNYECGRCSQDPESLLLQHNLRKFCRDIQPFSQDPTQLAEMIFNLLLEEKRILI
QAQRAQLEQGEPVLETPVESQQHEIESRILDLRAMMEKLVKSISQLKDQQDVFCFRYKIQ
AKGKTPSLDPHQTKEQKILQETLNELDKRRKEVLDASKALLGRLTTLIELLLPKLEEWKS
QQQKACIRAPIDHGLEQLETWFTAGAKLLFHLRQLLKELKGLSCLVSYQDDPLTKGVDLR
NAQVTELLQRLLHRAFVVETQPCMPQTPHRPLILKTGSKFTVRTRLLVRLQEGNESLTVE
VSIDRNPPQLQGFRKFNILTSNQKTLTPEKGQSQGLIWDFGYLTLVEQRSGGSGKGSNKG
PLGVTEELHIISFMVKYTYQGLKQELKTDTLPVVIISNMNQLSIAWASVLWFNLLSPNLQ
NQQFFSNPPKAPWSLLGPALSWQFSSYVGRGLNSDQLSMLRNKLFGQNCRTEDPLLSWAD
FTKRESPPGKLPFWTWLDKILELVHDHLKDLWNDGRIMGFVSRSQERRLLKKTISGTFLL
RFSESSEGGITCSWVEHQDDDKVLIYSVQPYTKEVLQSLPLTEIIRHYQLLTEENIPENP
LRFLYPRIPRDEAFGCYYQEKVNLQERRKYLKHRLIVVSNSSASVNRQKGALPSPGWSTR
MMLLLILPFPISFEPLSPAPLSVFGYPDSVLESTLEPVIEPTLCMVSQTVPEPDRGPLSQ
PVPEPDLPCDLRYLNTEPMEIFRNCVKIEEIMPNGDPLLAGQNTVDEVYVSRPSHFYTDG
PLMPSDF
Download sequence
Identical sequences ENSGGOP00000020290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]