SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020299 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020299
Domain Number 1 Region: 1064-1327
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.32e-32
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 381-614
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.49e-31
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 3 Region: 11-154,201-272
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.28e-31
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 4 Region: 743-898,938-1016
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.28e-29
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000020299
Domain Number - Region: 1332-1479
Classification Level Classification E-value
Superfamily EF-hand 0.00979
Family Calmodulin-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020299   Gene: ENSGGOG00000003649   Transcript: ENSGGOT00000024226
Sequence length 2021
Comment pep:known_by_projection chromosome:gorGor3.1:3:55078715:55247066:1 gene:ENSGGOG00000003649 transcript:ENSGGOT00000024226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILISVPFSVSSSSPAPAFLEKVEYAFLIIFTVETFLKIIAYGLLLHPNAYVRNGWNLLDF
VIVIVGLFSVILEQLTKETEGGNHSSGKSGGFDVKALRAFRVLRPLRLVSGVPSLQVVLN
SIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHKTCFFADSDIVAEEDPAPCAFSGN
GRQCTANGTECRSGWVGPNGGITNFDNFAFAMLTVFQCITMEGWTDVLYWMNDAMGFELP
WVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWI
TQAEDIDPENEEEGGEEGKRNTSMPTSETESVNTENVSGEGENRGCCGSLCQAISKSKLS
RRWRRWNRFNRRRCRAAVKSVTFYWLVIILVFLNTLTISSEHYNQPDWLTQIQDIANKVL
LALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELEIMSPLGISVFRCVR
LLRIFKVTRHWTSLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQ
TKRSTFDNFPQALLTVFQILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYI
LLNVFLAIAVDNLADAESLNTAQKEEAEEKERKKIARKESLENKKNNKPEVNQIANSDNK
VTIDDYREEDEDKDPYPPCDVPVSQEQEGFDSYEPEVPAGPRPRRISELNMKEKIAPIPD
GSAFFILSKTNPIRVGCHKLINHHIFTNLILVFIMLSSAALAAEDPIRSHSFRNTILGYF
DYAFTAIFTVEILLKMTTFGAFLHKGAFCRNYFNLLDMLVVGVSLVSFGIQSSAISVVKI
LRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFY
RCTDEAKSNPEECRGLFILYKDGDVDSPVVRERIWQNSDFNFDNVLSAMMALFTVSTFEG
WPALLYKAIDSNGENIGPIYNHRVEISIFFIIYIIIVAFFMMNIFVGFVIVTFQEQGEKE
YKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVNSSPFEYMMFVLIMLNTLCL
AMQHYEQSKMFNDAMDILNMVFTGVFTVEMVLKVIAFKPKGYFSDAWNTFDSLIVIGSII
DVALSEADPTESENVPVPTATPGNSEESNRISITFFRLFRVMRLVKLLSRGEGIRTLLWT
FIKSFQALPYVALLIAMLFFIYAVIGMQMFGKVAMRDNNQINRNNNFQTFPQAVLLLFRK
RCATGEAWQEIMLACLPGKLCDPESDYNPGEEYTCGSNFAIVYFISFYMLCAFLIINLFV
AVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGK
LCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGNLEQANEELRAVIKKI
WKKTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFRKFKKRKEQGLVGKYPAKNTTIAL
QAGLRTLHDIGPEIRRAISCDLQDDEPEETKREEEDDVFKRNGALLGNHVNHVNSDRRDS
LQQTNTTHRPLHVQRPSIPPASDTEKPLFPPAGNSVCHNHHNHNSIGKQVPTSTNANLNN
ANMSKAAHGKRPSIGNLEHVSENGHHSSHKHDREPQRRSSVKRTRYYETYIRSDSGDEQL
PTICREDPEIHGYFRDPHCLGEQEYFSSEECYEDDSSPTWSRQNYGYYSRYPGRNIDSER
PRGYHHPQGFLEDDDSPICYDSRRSPRRRLLPPTPASHRRSSFNFECLRRQSSQEEVPSS
PIFPHRTALPLHLMQQQIMAVAGLDSSKAQKYSPSHSTRSWATPPATPPYRDWTPCYTPL
IQVEQSEALDQVNGSLPSLHRSSWYTDEPDISYRTFTPASLTVPSSFRNKNSDKQRSADS
LVEAVLISEGLGRYARDPKFVSATKHEIADACDLTIDEMESAASTLLNGNVHPRANGDVG
PLSHRQDYELQDFGPGYSDEEPDPGRDEEDLADEMICITTL
Download sequence
Identical sequences ENSGGOP00000020299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]