SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020311 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020311
Domain Number 1 Region: 298-382
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.36e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 2 Region: 391-463
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000117
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 3 Region: 99-201
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000278
Family Eukaryotic type KH-domain (KH-domain type I) 0.0021
Further Details:      
 
Domain Number 4 Region: 4-88
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000966
Family Canonical RBD 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000020311
Domain Number - Region: 223-256
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000833
Family Eukaryotic type KH-domain (KH-domain type I) 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020311   Gene: ENSGGOG00000010286   Transcript: ENSGGOT00000031504
Sequence length 481
Comment pep:known_by_projection chromosome:gorGor3.1:7:23585144:23643436:-1 gene:ENSGGOG00000010286 transcript:ENSGGOT00000031504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLDSLLVQYGVVESCEQVNTDSETAVVNVTYSSKDQARQALDKLNGFQLENFTLKVAYIP
DEMAAQQNPLQQPRGRRGLGQRGSSRQGSPGSVSKQKPCDLPLRLLVPTQFVGAIIGKEG
ATIRNITKQTQSKIDVHRKENAGAAEKSITILSTPEGTSAACKSILEIMHKEAQDIKLNV
IIKVKILKKNSYFNLNSKKTGKNMDLIELYVPSISRLQELTLYNPERTITVKGNVETCAK
AEEEIMKKIRESYENDIASMNLQAHLIPGLNLNALGLFPPTSGMPPPTSGPPSAMTPPYP
QFEQSETETVHLFIPALSVGAIIGKQGQHIKQLSRFAGASIKIAPAEAPDAKVRMVIITG
PPEAQFKAQGRIYGKIKEENFVSPKEEVKLEAHIRVPSFAAGRVIGKGGKTVNELQNLSS
AEVVVPRDQTPDENDQVVVKITGHFYACQVAQRKIQEILTQVKQHQQQKALQSGPPQSRR
K
Download sequence
Identical sequences ENSGGOP00000020311 ENSGGOP00000010043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]