SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020361 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020361
Domain Number 1 Region: 27-130
Classification Level Classification E-value
Superfamily GINS helical bundle-like 8.89e-34
Family PSF3 C-terminal domain-like 0.00000106
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000020361
Domain Number - Region: 1-25
Classification Level Classification E-value
Superfamily PriA/YqbF domain 0.00111
Family PSF3 N-terminal domain-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020361   Gene: ENSGGOG00000017059   Transcript: ENSGGOT00000026224
Sequence length 155
Comment pep:novel chromosome:gorGor3.1:16:48368233:48369866:-1 gene:ENSGGOG00000017059 transcript:ENSGGOT00000026224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKIGPHFYGFGS
QLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYNEDTSALVARLDEMERGLFQTGQK
GLNDFQCWEKGQASQITASNLVQNYKKRKFTDMED
Download sequence
Identical sequences ENSGGOP00000020361 ENSGGOP00000020361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]