SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020461 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020461
Domain Number 1 Region: 314-383
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000471
Family HLH, helix-loop-helix DNA-binding domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000020461
Domain Number - Region: 374-462
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 0.0513
Family NADH oxidase/flavin reductase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020461   Gene: ENSGGOG00000002683   Transcript: ENSGGOT00000023490
Sequence length 561
Comment pep:known_by_projection chromosome:gorGor3.1:6:42892738:42900268:-1 gene:ENSGGOG00000002683 transcript:ENSGGOT00000023490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEEDRTFSFGPGTRKLGFMSQLSPACSATLGKSLPLSGLGVFPSKMDAVPVILASPCQP
LCFEEDTCLIYLPPLLVHREPAPAATMASRIGLRMQLMREQAQQEEQRERMQQQAVMHYM
QQQQQQQQQLGGPPTPAINTPVHFQSPRALAFSASQVQSYLENPTSYHLQQSQHQKVREY
LSETYGNKFAAHISPAQGSPKPPPAASPGVRAGHVLSSSAGNSAPNSPMAMLHIGSNPER
ELDDVIDNIMRLDDVLGYINPEMQMPNTLPLSSSHLNVYSSDPQVTASLVGVTSSSCPAD
LTQKRELTDAESRALAKERQKKDNHNLIERRRRFNINDRIKELGMLIPKANDLDVRWNKG
TILKASVDYIRRMQKDLQKSRELENHSRRLEMTNKQLWLRIQELEMQARVHGLPTTSPSG
MNMAELAQQVVKQELPSEEGPGEALMLGAEVPDPEPLPALPPQAPLPLPTQPPSPFHHLD
FSHSLSFGGREDEGPPGYPEPLAPGHGSPFPSLSKKDLDLMLLDDSLLPLASDPLLSTMS
PEASKASSRRSSFSMEEGDVL
Download sequence
Identical sequences ENSGGOP00000002644 ENSGGOP00000020461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]