SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020501 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020501
Domain Number 1 Region: 70-345
Classification Level Classification E-value
Superfamily L domain-like 6.12e-51
Family Ngr ectodomain-like 0.011
Further Details:      
 
Domain Number 2 Region: 351-585
Classification Level Classification E-value
Superfamily L domain-like 2.83e-47
Family Ngr ectodomain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020501   Gene: ENSGGOG00000005637   Transcript: ENSGGOT00000026845
Sequence length 614
Comment pep:known_by_projection chromosome:gorGor3.1:1:54749768:54773127:1 gene:ENSGGOG00000005637 transcript:ENSGGOT00000026845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQSRVLLLLLLLPPQLHLGPVLAVRAPGFGRSGGHSLSPEENEFAEEEPVLVLSPEEPG
PGPAAVSCPRDCACSQEGVVDCGGIDLREFPGDLPEHTNHLSLQNNQLEKIYPEELSRLH
RLETLNLQNNRLTSRGLPEKAFEHLTNLNYLYLANNKLTLAPRFLPNALISVDFAANYLT
KIYGLTFGQKPNLRSVYLHNNKLADAGLPDNMFNGSSNVEVLILSSNFLRHVPKHLPPAL
YKLHLKNNKLEKIPPGAFSELSSLRELYLQNNYLTDEGLDNETFWKLSSLEYLDLSSNNL
SRVPAGLPRSLVLLHLEKNAIRSVDADVLTPIRSLEYLLLHSNQLRAQGIHPLAFQGLKR
LHTVHLYNNALERVPSGLPRRVRTLMILHNQITGIGREDFATTYFLEELNLSYNRITSPQ
VHRDAFRKLRLLRSLDLSGNRLHTLPPGLPRNVHVLKVKRNELAALARGALAGMAQLREL
YLTSNRLRSRALGPRAWVDLAHLQLLDIAGNQLTEIPEGLPESLEYLYLQNNKISAVPAN
AFNSTPNLKGIFLRFNKLAVGSVVDSAFRRLKHLQVLDIEGNLEFGDVSKDRGRLGKEKE
EEEEEEEEEEETRQ
Download sequence
Identical sequences ENSGGOP00000020501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]