SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020507 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020507
Domain Number 1 Region: 18-175
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.91e-29
Family G proteins 0.000000333
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020507   Gene: ENSGGOG00000011718   Transcript: ENSGGOT00000033836
Sequence length 197
Comment pep:known_by_projection chromosome:gorGor3.1:12:15275184:15287242:-1 gene:ENSGGOG00000011718 transcript:ENSGGOT00000033836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CAKQINKLFFEMLLFSSTALVVRFLTKRFIWEYDPTLVSVYLNEAVLNSEILKQKCLANS
QQEDTIQREGHMRWGEGFVLVYDITDRRSFEEVLPLKNVLDEIKKPKNVTLILVGNKADL
DHSRQVSTEEGERLATELACAFYECSACTGEGNITEIFYELCREVRRRRMVQGKTRRRSS
TTHVKQAINKMLTKISS
Download sequence
Identical sequences ENSGGOP00000020507 ENSGGOP00000011424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]