SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020518 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020518
Domain Number 1 Region: 1-89
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.14e-18
Family THAP domain 0.00068
Further Details:      
 
Domain Number 2 Region: 249-532,581-724
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000091
Family Hermes transposase-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020518   Gene: ENSGGOG00000024317   Transcript: ENSGGOT00000023170
Sequence length 756
Comment pep:novel chromosome:gorGor3.1:8:77217146:77219431:-1 gene:ENSGGOG00000024317 transcript:ENSGGOT00000023170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNFCAVPNCTRKSTQSDLAFFRFPRDPARCQKWVENCRRADLEDKTPDHLNKHYRLCAQ
HFETSMICRTSPYRTVLRDNAIPTIFDLTSHLNNPRSRHRKRIKELSEDEIRTLKQKKID
ETSEQEQKHKETNNSNAQNPGEEEGEGQDEDILPLTLEEKENKEYLKSLFEILILMGKQN
IPLHGHEADEIPEGLFTPDNFQALLECRINSGEEVLRKRFETTAVNTLFCSKTQQRQMLE
ICESCIREETLREVRDSHFFSVITDDVVDIAGEEHLPVLVRFVDESHNLREEFIGFLPYE
ADAEILAVKFHTMITEKWGLNMEYCRGQAYIVSSGFSSKMKVVASRLLEKYPRAIYTLCS
FCALNMWLAKSVPVMGVSVALGTIEEVCSFFHRSPQLLLEFDNVISVLFQNSKERGKELK
EICHFQWTGRHDAFEILVELLQALVLCLDGINSDTNIRWNNCIADRAFVLCSAVTDFDFI
VTIVVLKNVLSFTRAFGKNLQGQTSDVFFAAGSLTAVLHSLNELMENIQVYHEFWFEEAT
NLATKLVIQMKLPGKFRRAHQGNLESQLTSESCYKETLSVPTVEHIIQELKDIFSEQHLK
ALKCLSLVPSVMGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIELPS
TIYEALQLPDIKFFPNVYALLKVLCILPVMKVENERYENGSYLRNTLTDQRSSNLALLNI
NFDIKHDLDLMVDTYIKLYTSKSELPTDNSETVENT
Download sequence
Identical sequences ENSGGOP00000020518 ENSGGOP00000020518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]