SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020534 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020534
Domain Number 1 Region: 704-1026
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-91
Family p120GAP domain-like 0.0000000000112
Further Details:      
 
Domain Number 2 Region: 324-431
Classification Level Classification E-value
Superfamily SH2 domain 1.88e-27
Family SH2 domain 0.00069
Further Details:      
 
Domain Number 3 Region: 145-244
Classification Level Classification E-value
Superfamily SH2 domain 1.27e-26
Family SH2 domain 0.00048
Further Details:      
 
Domain Number 4 Region: 449-556
Classification Level Classification E-value
Superfamily PH domain-like 1.32e-24
Family Pleckstrin-homology domain (PH domain) 0.0066
Further Details:      
 
Domain Number 5 Region: 252-325
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000525
Family SH3-domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020534   Gene: ENSGGOG00000001591   Transcript: ENSGGOT00000024108
Sequence length 1033
Comment pep:known_by_projection chromosome:gorGor3.1:5:70025346:70147588:1 gene:ENSGGOG00000001591 transcript:ENSGGOT00000024108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAAEAGSEGGPVTAGAGGGGAAAGSSAYPAVCRVKIPAALPVAAAPYPGLVETGVAGTL
GGGAALGSGFLGAGSVAGTLGGAGLTGGGPSGDMALTKLPTSLPAETLGPGGGFPPLPPP
PYLPPLGAGLGTVDEGDSLDGPEYEEEEVAIPLTAPPTNQWYHGKLDRTIAEERLRQAGK
SGSYLIRESDRRPGSFVLSFLSQMNVVNHFRIIAMCGDYYIGGRRFSSLSDLIGYYSHVS
CLLKGEKLLYPVAPPEPVEDRRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWV
TNLRTDEQGLIVEDLVEEVGREEDPHEGKIWFHGKISKQEAYNLLMTVGQVCSFLVRPSD
NTPGDYSLYFRTNENIQRFKICPTPNNQFMMGGRYYNSIGDIIDHYRKEQIVEGYYLKEP
VPMQDQEQVLNDTVDGKEIYNTIRRKTKDAFYKNIVKKGYLLKKGKGKRWKNLYFILEGS
DAQLIYFESEKRATKPKGLIDLSVCSVYVVHDSLFGRPNCFQIVVQHFSEEHYIFYFAGE
TPEQAEDWMKGLQAFCNLRKSSPGTSNKRLRQLRNSFIEIESSRKGVFHYFSRNILGEIT
CKIKLHCVYLLVCHIQIYNQSSHFLKKSSFSDLPPDINRFEITLSNKTKKSKDPDILFMR
CQLSRLQKGHATDEWFLLSSHIPLKGIEPGSLRVRARYSMEKIMPEEEYSEFKELILQKE
LHVVYALSHVCGQDRTLLASILLRIFLHEKLESLLLCTLNDREISMEDEATTLFRATTLA
STLMEQYMKATATQFVHHALKDSILKIMESKQSCELSPSKLEKNEDVNTNLTHLLNILSE
LVEKIFMASEILPPTLRYIYGCLQKSVQHKWPTNTTMRTRVVSGFVFLRLICPAILNPRM
FNIISDSPSPIAARTLILVAKSVQNLANLVEFGAKEPYMEGVNPFIKSNKHRMIMFLDEL
GNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQHVLKKLLAITELLQ
QKQNQYTKTNDVR
Download sequence
Identical sequences ENSGGOP00000001571 ENSGGOP00000020534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]