SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020583 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020583
Domain Number 1 Region: 223-336,407-441
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000113
Family Calmodulin-like 0.038
Further Details:      
 
Domain Number 2 Region: 347-439
Classification Level Classification E-value
Superfamily EF-hand 0.000000447
Family Penta-EF-hand proteins 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020583   Gene: ENSGGOG00000004841   Transcript: ENSGGOT00000030639
Sequence length 478
Comment pep:known_by_projection chromosome:gorGor3.1:10:84958003:85229247:-1 gene:ENSGGOG00000004841 transcript:ENSGGOT00000030639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRLNSLSALAELAVGSRWYHGGSQPIQIRRRLMMVAFLGASAVTASTGLLWKRSRAHAE
SPPCVDNLKSDIGDKGKNKDEGDVCNHEKKTADLVPHPEEKKKKRSGFRDRKVMEYENRI
RAYSTPDKIFRYFATLKVISEPGEAEVFMTPEDFVRSITPNEKQPEHLGLDQYIIKRFDG
KKISQEREKFADEGSIFYTLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEV
DMEEFEQVQSIIRSQTSMGMRHRDRPTTGNTLKSGLCSALTTYFFGADLKGKLTIKNFLE
FQRKLQHDVLKLEFERHDPVDGRITERQFGGMLLAYSGVQSKKLTAMQRQLKKHFKEGKG
LTFQEVENFFTFLKNINDVDTALSFYHMAGASLDKVTMQQVARTVAKVELSDHVCDVVFA
LFDCDGNGELSNKEFVSIMKQRLMRGLEKPKDMGFTRLMQAMWKCAQETAWDFALPKQ
Download sequence
Identical sequences ENSGGOP00000020583 ENSGGOP00000020583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]